Recombinant Mouse Rtn3 protein, His-tagged

• Cat.No.: Rtn3-5633M
• Product Overview: Recombinant Mouse Rtn3 protein(Q9ES97)(182-440aa), fused with C-terminal His tag, was expressed in Yeast.

Specification

• Source: Yeast
• Species: Mouse
• Tag: C-His
• Protein length: 182-440aa
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 29.9 kDa
• AASequence: KDQEPKNPNKVPDGEDRSALDFGQSKAEHICTYSLSPSELPVASVEKDSPESPFEVIIDKATFDREFKDLYKENPNDLGGWAAHGDRESPADLLEMNDKLFPLRNKEAGRYPSSVLLGRQFSHTTAALEEVSRCVNDMHNFTNEILTWDLDPQAKQQANKTSCTTESTGLDRSELRSEIPVINLKTNPQQKMPVCSFNGSTPITKSTGDWTEAFTEGKPVRDYLSSTKEAGGNGVPGSSQLHSELPGSMPEKWVSGSGA
• Purity: Greater than 85% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C.

Gene Information

• Gene Name: Rtn3 reticulon 3 [ Mus musculus ]
• Official Symbol: Rtn3
• Synonyms: RTN3; reticulon 3; reticulon-3; Nsp-like II; RTN3-A1; AW558451; MGC105197
• Gene ID: 20168
• mRNA Refseq: NM_001003933
• Protein Refseq: NP_001003933