Recombinant Mouse Rhox5 protein, GST-tagged

• Cat.No.: Rhox5-301540M
• Product Overview: Recombinant Mouse Rhox5 (1-106 aa) protein, fused to GST tag, was expressed in E. coli.

Specification

• Species: Mouse
• Source: E.coli
• Tag: GST
• Protein Length: Met1-Ser106
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization.
• AA Sequence: MEAEGSSRKVTRLLRLGVKEDSEEQHDVKAEAFFQAGEGRDEQGAQGQPGVGAVGTEGEGEELNGGKGHFGPGAPGPMGDGDKDSGTRAGGVEQEQNEPVAEGTES
• Purity: 85%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Stability: Store for up to 12 months at -20°C to -80°C as lyophilized powder.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks).
  Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.

Gene Information

• Gene Name: Rhox5 reproductive homeobox 5 [ Mus musculus ]
• Official Symbol: Rhox5
• Synonyms: RHOX5; reproductive homeobox 5; homeobox protein Rhox5; homeobox protein Pem; placentae and embryos oncofetal; reproductive homeobox on chromosome X 5; reproductive homeobox on X chromosome, 5; placenta and embryonic expression protein; Pem; AA409564
• Gene ID: 18617
• mRNA Refseq: NM_008818
• Protein Refseq: NP_032844