Recombinant Mouse Raet1e Protein, His tagged
Cat.No. : | Raet1e-02M |
Product Overview : | Recombinant mouse Raet1e (29-227 aa), fused to His-tag at C-terminus, was expressed in insect cell and purified by using conventional chromatography techniques. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | Insect cells |
Tag : | His |
Protein Length : | 29-227 aa |
Description : | Enables natural killer cell lectin-like receptor binding activity. Acts upstream of or within T cell mediated cytotoxicity. Predicted to be located in intracellular membrane-bounded organelle and plasma membrane. Predicted to be active in external side of plasma membrane and extracellular space. Is expressed in embryo; embryo endoderm; and midgut. Orthologous to human RAET1G (retinoic acid early transcript 1G) and RAET1L (retinoic acid early transcript 1L). |
Source : | Insect cells |
Species : | Mouse |
Tag : | C-His |
Form : | Liquid |
Molecular Weight : | 23.5 kDa (207aa) |
AA Sequence : | LDDAHSLRCNLTIKDPTSADLPWCDVKCSVDEITILHLNNINKTMTSGDPGKMANATGKCLTQPLNDLCQELRDKVSNTKVDTHKTNGYPHLQVTMIYPQSQGQTPSATWEFNISDSYFFTFYTENMSWRSANDESGVIMNKWKDDGDLVQQLKYFIPQCRQKIDEFLKQSKEKPRSTSRSPSITQLTSTSPLPPPSHSLEHHHHHH |
Endotoxin : | < 1 EU/μg by LAL |
Purity : | > 95% by SDS-PAGE |
Applications : | SDS-PAGE |
Storage : | Can be stored at +2 to +8 centigrade for 1 week. For long term storage, aliquot and store at -20 to -80 centigrade. Avoid repeated freezing and thawing cycles. |
Storage Buffer : | Phosphate-Buffered Saline (pH 7.4) containing 10% glycerol |
Concentration : | 0.5 mg/mL (determined by absorbance at 280nm) |
Reference : | 1. Diefenbach A., et al. (2000) Nat Immunol. 1:119-126. 2. Cerwenka A., et al. (2001) Proc Natl Acad Sci USA. 98:11521-11526. |
Gene Name | Raet1e retinoic acid early transcript 1E [ Mus musculus (house mouse) ] |
Official Symbol | Raet1e |
Synonyms | RAET1E; retinoic acid early transcript 1E; retinoic acid early-inducible protein 1-epsilon; RAE-1-epsilon; Rae-1 epsilon |
Gene ID | 379043 |
mRNA Refseq | NM_198193 |
Protein Refseq | NP_937836 |
UniProt ID | Q9CZQ6 |
◆ Recombinant Proteins | ||
RAET1E-206H | Recombinant Human RAET1E Protein, His-tagged | +Inquiry |
RAET1E-2937H | Recombinant Human RAET1E protein, His-tagged | +Inquiry |
RAET1E-764H | Recombinant Human RAET1E Protein, Fc-tagged | +Inquiry |
Raet1e-02M | Recombinant Mouse Raet1e Protein, His tagged | +Inquiry |
RAET1E-765H | Recombinant Human RAET1E Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
RAET1E-2549HCL | Recombinant Human RAET1E 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Raet1e Products
Required fields are marked with *
My Review for All Raet1e Products
Required fields are marked with *
0
Inquiry Basket