Recombinant Mouse Ptges Full Length Transmembrane protein, His-SUMO-tagged

• Cat.No.: Ptges-483M
• Product Overview: Recombinant Mouse Ptges protein(Q9JM51)(1-153aa), fused with N-terminal His-SUMO tag, was expressed in in vitro E. coli expression system.

Specification

• Species: Mouse
• Source: E.coli
• Tag: His&SUMO
• Protein Length: 1-153aa
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
  If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• AA Sequence: MPSPGLVMESGQVLPAFLLCSTLLVIKMYAVAVITGQMRLRKKAFANPEDALKRGGLQYY RSDPDVERCLRAHRNDMETIYPFLFLGFVYSFLGPNPLIAWIHFLVVLTGRVVHTVAYLG KLNPRLRSGAYVLAQFSCFSMALQILWEVAHHL
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C.

Gene Information

• Gene Name: Ptges prostaglandin E synthase [ Mus musculus ]
• Official Symbol: Ptges
• Synonyms: PTGES; prostaglandin E synthase; microsomal prostaglandin E synthase 1; Pges; mPGES; mPGES-1; D2Ertd369e; 2410099E23Rik
• Gene ID: 64292
• mRNA Refseq: NM_022415
• Protein Refseq: NP_071860