Recombinant Mouse PRSS29 Protein (18-279 aa), His-B2M-tagged

• Cat.No.: PRSS29-1112M
• Product Overview: Recombinant Mouse PRSS29 Protein (18-279 aa) is produced by E. coli expression system. This protein is fused with a 6xHis-B2M tag at the N-terminal. Protein Description: Full Length of Mature Protein.

Specification

• Species: Mouse
• Source: E.coli
• Tag: B2M&His
• Protein Length: 18-279 aa
• Description: Involved in bryo hatching and implantation.
• Form: Tris-based buffer, 50% glycerol
• Molecular Mass: 43.1 kDa
• AA Sequence: GTPAPGPEDVLMGIVGGHSAPQGKWPWQVSLRIYRYYWAFWVHNCGGSIIHPQWVLTAAHCIRERDADPSVFRIRVGEAYLYGGKELLSVSRVIIHPDFVHAGLGSDVALLQLAVSVQSFPNVKPVKLPSESLEVTKKDVCWVTGWGAVSTHRSLPPPYRLQQVQVKIIDNSLCEEMYHNATRHRNRGQKLILKDMLCAGNQGQDSCYGDAGGPLVCNVTGSWTLVGVVSWGYGCALRDFPGVYARVQSFLPWITQQMQRFS
• Purity: > 90% as determined by SDS-PAGE.
• Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
• Concentration: A hardcopy of COA with concentration instruction is sent along with the products.

Gene Information

• Gene Name: Prss29 protease, serine 29 [ Mus musculus (house mouse) ]
• Official Symbol: PRSS29
• Synonyms: Isp2; D19363; mISP-2
• Gene ID: 114662
• mRNA Refseq: NM_053260
• Protein Refseq: NP_444490
• UniProt ID: Q99MS4