Recombinant Mouse Prok2 protein, His-B2M-tagged

• Cat.No.: Prok2-545M
• Product Overview: Recombinant Mouse Prok2 protein(Q9QXU7)(27-128aa), fused with N-terminal His and B2M tag, was expressed in E.coli.

Specification

• Species: Mouse
• Source: E.coli
• Tag: B2M&His
• Protein Length: 27-128aa
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 25.5 kDa
• Purity: Greater than 85% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C.
• AA Sequence: AVITGACDKDSQCGGGMCCAVSIWVKSIRICTPMGQVGDSCHPLTRKSHVANGRQERRRAKRRKRKKEVPFWGRRMHHTCPCLPGLACLRTSFNRFICLARK

Gene Information

• Gene Name: Prok2 prokineticin 2 [ Mus musculus ]
• Official Symbol: Prok2
• Synonyms: PROK2; prokineticin 2; prokineticin-2; prokineticin 1; protein Bv8 homolog; Bombina variegata 8 kD protein; Bombina variegata 8kDa protein; Bv 8 homolog (Bombina variegata); Bv8; PK2; Prok1
• Gene ID: 50501
• mRNA Refseq: NM_001037539
• Protein Refseq: NP_001032628