Recombinant Mouse Prkaa1 protein, His-tagged

• Cat.No.: Prkaa1-4504M
• Product Overview: Recombinant Mouse Prkaa1 protein(Q5EG47)(1-312aa), fused to N-terminal His tag, was expressed in E. coli

Specification

• Species: Mouse
• Source: E.coli
• Tag: His
• Protein Length: 1-312aa
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
  If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 39.8 kDa
• AA Sequence: MRRLSSWRKMATAEKQKHDGRVKIGHYILGDTLGVGTFGKVKVGKHELTGHKVAVKILNRQKIRSLDVVGKIRREIQNLKLFRHPHIIKLYQVISTPSDIFMVMEYVSGGELFDYICKNGRLDEKESRRLFQQILSGVDYCHRHMVVHRDLKPENVLLDAHMNAKIADFGLSNMMSDGEFLRTSCGSPNYAAPEVISGRLYAGPEVDIWSSGVILYALLCGTLPFDDDHVPTLFKKICDGIFYTPQYLNPSVISLLKHMLQVDPMKRAAIKDIREHEWFKQDLPKYLFPEDPSYSSTMIDDEALKEVCEKFE
• Purity: Greater than 85% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%.

Gene Information

• Gene Name: Prkaa1 protein kinase, AMP-activated, alpha 1 catalytic subunit [ Mus musculus ]
• Official Symbol: Prkaa1
• Synonyms: PRKAA1; protein kinase, AMP-activated, alpha 1 catalytic subunit; 5-AMP-activated protein kinase catalytic subunit alpha-1; AMPK subunit alpha-1; tau-protein kinase PRKAA1; AMP-activated protein kinase, alpha 1 catalytic subunit; AI194361; AI450832; AL024255; AMPKalpha1; C130083N04Rik
• Gene ID: 105787
• mRNA Refseq: NM_001013367
• Protein Refseq: NP_001013385