Recombinant Mouse Ppia Protein, His-tagged

• Cat.No.: Ppia-7385M
• Product Overview: Recombinant mouse ppiA, fused to His-tag at N-terminus, was expressed in E. coli and purified by using conventional chromatography techniques.

Specification

• Species: Mouse
• Source: E.coli
• Tag: His
• Protein Length: 1-164
• Description: PPIases accelerate the folding of proteins. It catalyzes the cis-trans isomerization of proline imidic peptide bonds in oligopeptides.
• Form: Liquid
• Molecular Mass: 20.4 kDa
• AA Sequence: MGSSHHHHHHSSGLVPRGSHMGSMVNPTVFFDITADDEPLGRVSFELFADKVPKTAENFRALSTGEKGFGYKGSSFHRIIPGFMCQGGDFTRHNGTGGRSIYGEKFEDENFILKHTGPGILSMANAGPNTNGSQFFICTAKTEWLDGKHVVFGKVKEGMNIVEAMERFGSRNGKTSKKITISDCGQL
• Purity: > 95 % by SDS-PAGE
• Stability: Shelf life: one year from despatch.
• Storage: Store undiluted at 2-8 centigrade for one week or (in aliquots) at -20 to -80 centigrade for longer. Avoid repeated freezing and thawing.
• Concentration: 0.5 mg/mL (determined by Bradford assay)
• Storage Buffer: In Phosphate buffered saline (pH7.4) containing 10 % glycerol, 1 mM DTT.

Gene Information

• Gene Name: Ppia peptidylprolyl isomerase A [ Mus musculus (house mouse) ]
• Official Symbol: Ppia
• Synonyms: Ppia; peptidylprolyl isomerase A; Cp; Cy; Cphn; CypA; SP18; CyP-1; CyP-18; peptidyl-prolyl cis-trans isomerase A; PPIase A; cyclophilin A; cyclosporin A-binding protein; rotamase A; EC 5.2.1.8
• Gene ID: 268373
• mRNA Refseq: NM_008907
• Protein Refseq: NP_032933
• UniProt ID: P17742