Recombinant Human PPIA protein

• Cat.No.: PPIA-4082H
• Product Overview: Recombinant Human PPIA protein(P62937)(2-165aa) was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: Non
• Protein Length: 2-165aa
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
  If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 17.9 kDa
• AA Sequence: VNPTVFFDIAVDGEPLGRVSFELFADKVPKTAENFRALSTGEKGFGYKGSCFHRIIPGFMCQGGDFTRHNGTGGKSIYGEKFEDENFILKHTGPGILSMANAGPNTNGSQFFICTAKTEWLDGKHVVFGKVKEGMNIVEAMERFGSRNGKTSKKITIADCGQLE
• Purity: Greater than 90% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%.

Gene Information

• Gene Name: PPIA peptidylprolyl isomerase A (cyclophilin A) [ Homo sapiens ]
• Official Symbol: PPIA
• Synonyms: PPIA; peptidylprolyl isomerase A (cyclophilin A); peptidyl-prolyl cis-trans isomerase A; CYPA; PPIase A; rotamase A; cyclophilin; T cell cyclophilin; cyclosporin A-binding protein; CYPH; MGC12404; MGC23397; MGC117158
• Gene ID: 5478
• mRNA Refseq: NM_021130
• Protein Refseq: NP_066953
• MIM: 123840
• UniProt ID: P62937