Recombinant Mouse Pmaip1 protein, His-tagged

• Cat.No.: Pmaip1-3349M
• Product Overview: Recombinant Mouse Pmaip1 protein(Q9JM54)(1-103aa), fused to N-terminal His tag, was expressed in E. coli.

Specification

• Species: Mouse
• Source: E.coli
• Tag: His
• Protein Length: 1-103aa
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
  If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 15.6 kDa
• AA Sequence: MPGRKARRNAPVNPTRAELPPEFAAQLRKIGDKVYCTWSAPDITVVLAQMPGKSQKSRMRSPSPTRVPADLKDECAQLRRIGDKVNLRQKLLNLISKLFNLVT
• Purity: Greater than 85% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%.

Gene Information

• Gene Name: Pmaip1 phorbol-12-myristate-13-acetate-induced protein 1 [ Mus musculus ]
• Official Symbol: Pmaip1
• Synonyms: PMAIP1; phorbol-12-myristate-13-acetate-induced protein 1; protein Noxa; Noxa
• Gene ID: 58801
• mRNA Refseq: NM_021451
• Protein Refseq: NP_067426