Recombinant Mouse Pla2g5 Protein, His-SUMO-tagged

• Cat.No.: Pla2g5-1412M
• Product Overview: Recombinant Mouse Pla2g5 Protein (21-137aa) was expressed in E. coli with N-terminal His-SUMO-tag.

Specification

• Species: Mouse
• Source: E.coli
• Tag: His&SUMO
• Protein Length: 21-137 a.a.
• Form: Tris-based buffer, 50% glycerol
• Molecular Mass: 29.8kDa
• AA Sequence: GLLELKSMIEKVTGKNAFKNYGFYGCYCGWGGRGTPKDGTDWCCQMHDRCYGQLEEKDCAIRTQSYDYRYTNGLVICEHDSFCPMRLCACDRKLVYCLRRNLWTYNPLYQYYPNFLC
• Purity: > 90% as determined by SDS-PAGE.
• Storage: Store at -20 centigrade/-80 centigrade. Repeated freezing and thawing is not recommended.

Gene Information

• Gene Name: Pla2g5 phospholipase A2, group V [ Mus musculus (house mouse) ]
• Official Symbol: Pla2g5
• Synonyms: PLA2; sPLA2; Group V phospholipase A2; PLA2-10Phosphatidylcholine 2-acylhydrolase 5
• Gene ID: 18784
• mRNA Refseq: NM_001122954.1
• Protein Refseq: NP_001116426.1
• UniProt ID: P97391