Recombinant Mouse PDCD1LG2 Protein, Fc-tagged

Cat.No. : PDCD1LG2-719M
Product Overview : Recombinant Mouse PDCD1LG2 protein with Fc tag was expressed in HEK293.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Mouse
Source : HEK293
Tag : Fc
Protein Length : 247
Description : Acts upstream of or within negative regulation of T cell proliferation and positive regulation of T cell proliferation. Predicted to be located in plasma membrane. Predicted to be integral component of membrane. Predicted to be active in external side of plasma membrane. Is expressed in several structures, including alimentary system epithelium; forebrain; nose; retina; and skin. Orthologous to human PDCD1LG2 (programmed cell death 1 ligand 2).
Form : Lyophilized
Molecular Mass : 49.2 kDa
AA Sequence : MLLLLPILNLSLQLHPVAALFTVTAPKEVYTVDVGSSVSLECDFDRRECTELEGIRASLQKVENDTSLQSERATLLEEQLPLGKALFHIPSVQVRDSGQYRCLVICGAAWDYKYLTVKVKASYMRIDTRILEVPGTGEVQLTCQARGYPLAEVSWQNVSVPANTSHIRTPEGLYQVTSVLRLKPQPSRNFSCMFWNAHMKELTSAIIDPLSRMEPKVPRTWPLHVFIPACTIALIFLAIVIIQRKRI
Purity : > 98%
Applications : WB; ELISA; FACS; FC
Stability : This bioreagent is stable at 4 centigrade (short-term) and -70 centigrade(long-term). After reconstitution, sample may be stored at 4 centigrade for 2-7 days and below -18 centigrade for future use.
Storage : At -20 centigrade.
Concentration : 1 mg/mL
Storage Buffer : PBS (pH 7.4-7.5). Sterile-filtered colorless solution.
Reconstitution : Reconstitute in sterile distilled H2O to no less than 100 μg/mL; dilute reconstituted stock further in other aqueous solutions if needed. Please review COA for lot-specific instructions. Final measurements should be determined by the end-user for optimal performance.
Gene Name Pdcd1lg2 programmed cell death 1 ligand 2 [ Mus musculus (house mouse) ]
Official Symbol PDCD1LG2
Synonyms PDCD1LG2; programmed cell death 1 ligand 2; PD-1 ligand 2; PDCD1 ligand 2; butyrophilin B7-DC; butyrophilin-like protein; programmed death ligand 2; Btdc; B7-DC; PD-L2; F730015O22Rik; MGC124039; MGC124040;
Gene ID 58205
mRNA Refseq NM_021396
Protein Refseq NP_067371
UniProt ID Q9WUL5

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All PDCD1LG2 Products

Required fields are marked with *

My Review for All PDCD1LG2 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon