Recombinant Human PDCD1LG2 protein, His-tagged
Cat.No. : | PDCD1LG2-3324H |
Product Overview : | Recombinant Human PDCD1LG2 protein(Q9BQ51)(21-118aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Source : | E. coli |
Species : | Human |
Tag : | His |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 15.1 kDa |
Protein length : | 21-118aa |
AA Sequence : | FTVTVPKELYIIEHGSNVTLECNFDTGSHVNLGAITASLQKVENDTSPHRERATLLEEQLPLGKASFHIPQVQVRDEGQYQCIIIYGVAWDYKYLTLK |
Purity : | Greater than 85% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
Gene Name | PDCD1LG2 programmed cell death 1 ligand 2 [ Homo sapiens ] |
Official Symbol | PDCD1LG2 |
Synonyms | PDCD1LG2; programmed cell death 1 ligand 2; B7 dendritic cell molecule; B7 DC; bA574F11.2; Btdc; CD273; PD L2; PDL2; B7-DC; PD-1 ligand 2; PD-1-ligand 2; PDCD1 ligand 2; butyrophilin B7-DC; programmed death ligand 2; B7DC; PD-L2; PDCD1L2; MGC142238; MGC142240; |
Gene ID | 80380 |
mRNA Refseq | NM_025239 |
Protein Refseq | NP_079515 |
MIM | 605723 |
UniProt ID | Q9BQ51 |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All PDCD1LG2 Products
Required fields are marked with *
My Review for All PDCD1LG2 Products
Required fields are marked with *
0
Inquiry Basket