Recombinant Mouse P2ry1 Full Length Transmembrane protein, His-tagged

• Cat.No.: P2ry1-0496M
• Product Overview: Recombinant Mouse P2ry1 protein(P49650)(1-373aa), fused with N-terminal His tag, was expressed in in vitro E. coli expression system.

Specification

• Species: Mouse
• Source: E.coli
• Tag: His
• Protein Length: 1-373aa
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
  If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 48.3 kDa
• AA Sequence: MTEVPWSVVPNGTDAAFLAGLGSLWGNSTVASTAAVSSSFQCALTKTGFQFYYLPAVYILVFIIGFLGNSVAIWMFVFHMKPWSGISVYMFNLALADFLYVLTLPALIFYYFNKTDWIFGDAMCKLQRFIFHVNLYGSILFLTCISAHRYSGVVYPLKSLGRLKKKNAIYVSVLVWLIVVVAISPILFYSGTGTRKNKTVTCYDTTSNDYLRSYFIYSMCTTVAMFCIPLVLILGCYGLIVKALIYNDLDNSPLRRKSIYLVIIVLTVFAVSYIPFHVMKTMNLRARLDFQTPEMCDFNDRVYATYQVTRGLASLNSCVDPILYFLAGDTFRRRLSRATRKASRRSEANLQSKSEEMTLNILSEFKQNGDTSL
• Purity: Greater than 85% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C.

Gene Information

• Gene Name: P2ry1 purinergic receptor P2Y, G-protein coupled 1 [ Mus musculus ]
• Official Symbol: P2ry1
• Synonyms: P2RY1; purinergic receptor P2Y, G-protein coupled 1; P2Y purinoceptor 1; ATP receptor; P2Y1 receptor; P2Y1
• Gene ID: 18441
• mRNA Refseq: NM_008772
• Protein Refseq: NP_032798