Recombinant Mouse OCM Protein (2-109 aa), His-tagged

• Cat.No.: OCM-1974M
• Product Overview: Recombinant Mouse OCM Protein (2-109 aa) is produced by Yeast expression system. This protein is fused with a 6xHis tag at the N-terminal. Research Area: Neuroscience. Protein Description: Full Length of Mature Protein.

Specification

• Species: Mouse
• Source: Yeast
• Tag: His
• Protein Length: 2-109 aa
• Description: Has some calmodulin-like activity with respect to enzyme activation and growth regulation. Binds two calcium ions.
• Form: Tris-based buffer,50% glycerol
• Molecular Mass: 14.1 kDa
• AA Sequence: SITDILSADDIAAALQECQDPDTFEPQKFFQTSGLSKMSASQLKDIFQFIDNDQSGYLDEDELKYFLQRFQSDARELTESETKSLMDAADNDGDGKIGADEFQEMVHS
• Purity: > 90% as determined by SDS-PAGE.
• Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
• Concentration: A hardcopy of COA with reconstitution instruction is sent along with the products.

Gene Information

• Gene Name: Ocm oncomodulin [ Mus musculus ]
• Official Symbol: OCM
• Synonyms: OCM; oncomodulin; OM; parvalbumin beta
• Gene ID: 18261
• mRNA Refseq: NM_033039
• Protein Refseq: NP_149028
• UniProt ID: P51879