Recombinant Mouse NUS1 Protein (24-120 aa), His-tagged

• Cat.No.: NUS1-1705M
• Product Overview: Recombinant Mouse NUS1 Protein (24-120 aa) is produced by Yeast expression system. This protein is fused with a 6xHis tag at the N-terminal. Protein Description: Partial.

Specification

• Species: Mouse
• Source: Yeast
• Tag: His
• Protein Length: 24-120 aa
• Description: With DHDDS, forms the dehydrodolichyl diphosphate synthase (DDS) complex, an essential component of the dolichol monophosphate (Dol-P) biosynthetic machinery. Adds multiple copies of isopentenyl pyrophosphate (IPP) to farnesyl pyrophosphate (FPP) to produce dehydrodolichyl diphosphate (Dedol-PP), a precusrosor of dolichol which is utilized as a sugar carrier in protein glycosylation in the endoplasmic reticulum (ER). Regulates the glycosylation and stability of nascent NPC2, thereby promoting trafficking of LDL-derived cholesterol. Acts as a specific receptor for the N-terminus of Nogo-B, a neural and cardiovascular regulator.
• Form: Tris-based buffer,50% glycerol
• Molecular Mass: 13.0 kDa
• AA Sequence: SWLRVRFGTWNWIWRRCCRAASAAVLAPLGFTLRKPRAVGRNRRHHRHPHGGPGPGPGPAATHPRLRWRADVRSLQKLPVHMGLLVTEEVQEPSFSD
• Purity: > 90% as determined by SDS-PAGE.
• Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
• Concentration: A hardcopy of COA with reconstitution instruction is sent along with the products.

Gene Information

• Gene Name: Nus1 nuclear undecaprenyl pyrophosphate synthase 1 homolog (S. cerevisiae) [ Mus musculus ]
• Official Symbol: NUS1
• Synonyms: NUS1; nogo-B receptor; ngBR; AU019165; AW538011; BC003223; D10Ertd438e; MGC7199; 1600027K07Rik
• Gene ID: 52014
• mRNA Refseq: NM_030250
• Protein Refseq: NP_084526
• UniProt ID: Q99LJ8