Recombinant Mouse NRL Protein (1-237 aa), His-SUMO-Myc-tagged

• Cat.No.: NRL-2535M
• Product Overview: Recombinant Mouse NRL Protein (1-237 aa) is produced by E. coli expression system. This protein is fused with a 10xHis-SUMO tag at the N-terminal and a Myc tag at the C-terminal. Protein Description: Full Length.

Specification

• Description: Acts as a transcriptional activator which regulates the expression of several rod-specific genes, including RHO and PDE6B. Functions also as a transcriptional coactivator, stimulating transcription mediated by the transcription factor CRX and NR2E3. Binds in a sequence-specific manner to the rhodopsin promoter.
• Source: E. coli
• Species: Mouse
• Tag: His&Myc&SUMO
• Form: Tris-based buffer,50% glycerol
• Molecular Mass: 46.1 kDa
• Protein length: 1-237 aa
• AA Sequence: MAFPPSPLAMEYVNDFDLMKFEIKREPSEGRSGVPTASLGSTPYSSVPPSPTFSEPGMVGGGEAPRPGLEELYWLATLQQQLGSDEVLGLSPDEAVELLQNQGPVSMEGPLGYYSGSPGETGAQHVQLPERFSDAALVSMSVRELNRQLRGCGRDEALRLKQRRRTLKNRGYAQACRSKRLQQRRGLEAERARLAAQLDALRAEVARLARERDLYKARCDRLTSGGPGSDDHTHLFL
• Purity: > 85% as determined by SDS-PAGE.
• Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
• Concentration: A hardcopy of COA will be sent along with the products. Please refer to it for detailed information.

Gene Information

• Gene Name: Nrl neural retina leucine zipper gene [ Mus musculus ]
• Official Symbol: NRL
• Synonyms: NRL; neural retina leucine zipper gene; AW492574; D14H14S46E
• Gene ID: 18185
• mRNA Refseq: NM_001136074
• Protein Refseq: NP_001129546
• UniProt ID: P54846