Recombinant Mouse Npm1 Protein, His-SUMO-tagged
Cat.No. : | Npm1-1297M |
Product Overview : | Recombinant Mouse Npm1 Protein (1-292aa) was expressed in E. coli with N-terminal His-SUMO tag. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | E.coli |
Tag : | His&SUMO |
ProteinLength : | 1-292 a.a. |
Form : | Tris-based buffer, 50% glycerol. |
Molecular Mass : | 48.6 kDa |
AA Sequence : | MEDSMDMDMSPLRPQNYLFGCELKADKDYHFKVDNDENEHQLSLRTVSLGAGAKDELHIVEAEAMNYEGSPIKVTLATLKMSVQPTVSLGGFEITPPVVLRLKCGSGPVHISGQHLVAVEEDAESEDEDEEDVKLLGMSGKRSAPGGGNKVPQKKVKLDEDDEDDDEDDEDDEDDDDDDFDEEETEEKVPVKKSVRDTPAKNAQKSNQNGKDLKPSTPRSKGQESFKKQEKTPKTPKGPSSVEDIKAKMQASIEKGGSLPKVEAKFINYVKNCFRMTDQEAIQDLWQWRKSL |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | The shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Gene Name | Npm1 nucleophosmin 1 [ Mus musculus (house mouse) ] |
Official Symbol | Npm1 |
Synonyms | B23; Npm; NO38; Npm1 |
Gene ID | 18148 |
mRNA Refseq | NM_008722.3 |
Protein Refseq | NP_032748.1 |
UniProt ID | Q61937 |
◆ Recombinant Proteins | ||
MAB21L1-6102C | Recombinant Chicken MAB21L1 | +Inquiry |
Epha2-914M | Active Recombinant Mouse Epha2 protein(Met1-Asn535), His-tagged | +Inquiry |
PPP3R1-3471H | Recombinant Human PPP3R1, His-tagged | +Inquiry |
NID1-0185H | Recombinant Human NID1 protein, MYC/DDK-tagged | +Inquiry |
ANGPT2-152H | Recombinant Human ANGPT2 Protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
LDH2-123H | Active Native Human Lactate Dehydrogenase 2 | +Inquiry |
CAPN2-121B | Native Bovine CAPN2 | +Inquiry |
Heartworm-021C | Native Canine Heartworm Antigen | +Inquiry |
Collagen Type I-48H | Native Human tendon collagen type I | +Inquiry |
KLK1-29685TH | Native Human KLK1 | +Inquiry |
◆ Cell & Tissue Lysates | ||
WTAP-276HCL | Recombinant Human WTAP 293 Cell Lysate | +Inquiry |
GTF2F1-5700HCL | Recombinant Human GTF2F1 293 Cell Lysate | +Inquiry |
FKBP5-6204HCL | Recombinant Human FKBP5 293 Cell Lysate | +Inquiry |
PPM1B-2962HCL | Recombinant Human PPM1B 293 Cell Lysate | +Inquiry |
PPM1J-2958HCL | Recombinant Human PPM1J 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Npm1 Products
Required fields are marked with *
My Review for All Npm1 Products
Required fields are marked with *
0
Inquiry Basket