Recombinant Mouse Myl9 Protein, His-tagged

• Cat.No.: Myl9-7422M
• Product Overview: Recombinant mouse Myl9 with a His tag was expressed in E. coli and purified by using conventional chromatography techniques.

Specification

• Species: Mouse
• Source: E.coli
• Tag: His
• Protein Length: 1-172
• Description: Myosin regulatory subunit that plays an important role in regulation of both smooth muscle and nonmuscle cell contractile activity via its phosphorylation. Implicated in cytokinesis, receptor capping, and cell locomotion.
• Form: Liquid
• Molecular Mass: 22.4 kDa
• AA Sequence: MGSSHHHHHHSSGLVPRGSHMGSHMSSKRAKAKTTKKRPQRATSNVFAMFDQSQIQEFKEAFNMIDQNRDGFIDKEDLHDMLASLGKNPTDEYLEGMMNEAPGPINFTMFLTMFGEKLNGTDPEDVIRNAFACFDEEASGFIHEDHLRELLTTMGDRFTDEEVDEMYREAPIDKKGNFNYVEFTRILKHGAKDKDD
• Purity: > 90 % by SDS-PAGE
• Stability: Shelf life: one year from despatch.
• Storage: Store undiluted at 2-8 centigrade for one week or (in aliquots) at -20 to -80 centigrade for longer. Avoid repeated freezing and thawing.
• Concentration: 0.5 mg/mL (determined by bradford assay)
• Storage Buffer: Phosphate buffered saline (pH 7.4) containing 10 % glycerol, 1 mM DTT.

Gene Information

• Gene Name: Myl9 myosin, light polypeptide 9, regulatory [ Mus musculus (house mouse) ]
• Official Symbol: Myl9
• Synonyms: Myl9; myosin, light polypeptide 9, regulatory; RLC; MLC2; MLC20; Mylc2; RLC-C; Mylc2c; AI327049; myosin regulatory light polypeptide 9; myosin light chain, regulatory C; myosin regulatory light chain 9
• Gene ID: 98932
• mRNA Refseq: NM_172118
• Protein Refseq: NP_742116
• UniProt ID: Q9CQ19