Recombinant Mouse Mydgf protein
Cat.No. : | Mydgf-2338M |
Product Overview : | Recombinant Mouse Mydgf protein was expressed in Escherichia coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | E.coli |
Tag : | Non |
Protein Length : | 143 |
Description : | SF-20 or IL-25 belongs to the IL-17 family and is also named IL-17E. It is encoded by IL-25 (IL-17E) gene located on chromosome 14 in murine and secreted by several tissues at low levels, for instance, brain, kidney, lung, prostate, testis, spinal cord, adrenal gland, and trachea. This cytokine is initially identified as a product of bone marrow-derived stromal cells and plays an important role in proliferation of lymphoid cells and is considered an interleukin. It rest CD8+ and CD19+ cells and activated CD8+ T cells and has been shown to bind to the surface of cells expressing the receptor TSA-1 (Thymic shared Ag-1). Additionally, it induces the production of other cytokines, including IL-4, IL-5 and IL-13 in multiple tissues, which stimulate the expansion of eosinophils. |
Form : | Lyophilized from a 0.2μm filtered concentrated solution in PBS, pH 7.4. |
Molecular Mass : | Approximately 15.8 kDa, a single non-glycosylated polypeptide chain containing 143 amino acids. |
AA Sequence : | MVSEPTTVPFDVRPGGVVHSFSQDVGPGNKFTCTFTYASQGGTNEQWQMSLGTSEDSQHFTCTIWRPQGKSYLYFTQFKAELRGAEIEYAMAYSKAAFERESDVPLKSEEFEVTKTAVSHRPGAFKAELSKLVIVAKAARSEL |
Endotoxin : | Less than 1 EU/µg of rMuSF-20 as determined by LAL method. |
Purity : | >95% by SDS-PAGE and HPLC analysis. |
Storage : | Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 centigrade as supplied. 1 month, 2 to 8 centigrade under sterile conditions after reconstitution. 3 months, -20 to -70 centigrade under sterile conditions after reconstitution. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at ≤-20 centigrade. Further dilutions should be made in appropriate buffered solutions. |
Gene Name | Mydgf |
Official Symbol | Mydgf |
Synonyms | IL-17E, IL-25 |
Gene ID | 28106 |
mRNA Refseq | NM_080837.2 |
Protein Refseq | NP_543027.1 |
UniProt ID | Q9CPT4 |
◆ Recombinant Proteins | ||
Mydgf-242M | Recombinant Mouse Mydgf Protein, His-tagged | +Inquiry |
MYDGF-2332H | Recombinant Human MYDGF Protein, His-tagged | +Inquiry |
Mydgf-4242M | Recombinant Mouse Mydgf Protein | +Inquiry |
MYDGF-537H | Recombinant Human MYDGF Protein, Fc-tagged | +Inquiry |
Mydgf-2338M | Recombinant Mouse Mydgf protein | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Mydgf Products
Required fields are marked with *
My Review for All Mydgf Products
Required fields are marked with *
0
Inquiry Basket