Recombinant Mouse Mup1 Protein, His-tagged

• Cat.No.: Mup1-7287M
• Product Overview: Recombinant Mouse MUP1 protein, fused to His-tag at N-terminus, was expressed in E. coli and purified by using conventional chromatography.

Specification

• Species: Mouse
• Source: E.coli
• Tag: His
• Protein Length: 19-180
• Description: Restricted expression toward liver adult (RPKM 1970.0).
• Form: Liquid
• Molecular Mass: 21.1 kDa
• AA Sequence: MGSSHHHHHHSSGLVPRGSHMGSEEASSTGRNFNVEKINGEWHTIILASDKREKIEDNGNFRLFLEQIHVLENSLVLKFHTVRDEECSELSMVADKTEKAGEYSVTYDGFNTFTIPKTDYDNFLMAHLINEKDGETFQLMGLYGREPDLSSDIKERFAQLCEKHGILRENIIDLSNANRCLQARE
• Purity: > 95 % by SDS-PAGE
• Stability: Shelf life: one year from despatch.
• Storage: Store undiluted at 2-8 centigrade for one week or (in aliquots) at -20 to -80 centigrade for longer. Avoid repeated freezing and thawing.
• Concentration: 1.0 mg/mL (determined by BCA assay)
• Storage Buffer: 20 mM Tris-HCl buffer (pH 8.0) containing 10 % Glycerol, 0.1 M NaCl

Gene Information

• Gene Name: Mup1 major urinary protein 1 [ Mus musculus (house mouse) ]
• Official Symbol: Mup1
• Synonyms: Mup1; major urinary protein 1; Ltn; Lvt; Mup; Up-; Mup-; Mup7; Up-1; Ltn-1; Mup-1; Mup-a; Mup10; Lvtn-1; major urinary protein 1; MUP 1; major urinary protein 10; major urinary protein 7
• Gene ID: 17840
• mRNA Refseq: NM_001163010
• Protein Refseq: NP_001156482
• UniProt ID: A2CEL1