Recombinant Mouse MGLL Protein (1-303 aa), His-tagged

• Cat.No.: MGLL-2105M
• Product Overview: Recombinant Mouse MGLL Protein (1-303 aa) is produced by Yeast expression system. This protein is fused with a 6xHis tag at the N-terminal. Research Area: Cardiovascular. Protein Description: Full Length.

Specification

• Species: Mouse
• Source: Yeast
• Tag: His
• Protein Length: 1-303 aa
• Description: Converts monoacylglycerides to free fatty acids and glycerol. Hydrolyzes the endocannabinoid 2-arachidonoylglycerol, and thereby contributes to the regulation of endocannabinoid signaling, nociperception and perception of pain (PubMed:9341166, PubMed:17700715, PubMed:18096503, PubMed:19029917, PubMed:20729846). Regulates the levels of fatty acids that serve as signaling molecules and promote cancer cell migration, invasion and tumor growth (By similarity).
• Form: Tris-based buffer,50% glycerol
• Molecular Mass: 35.4 kDa
• AA Sequence: MPEASSPRRTPQNVPYQDLPHLVNADGQYLFCRYWKPSGTPKALIFVSHGAGEHCGRYDELAHMLKGLDMLVFAHDHVGHGQSEGERMVVSDFQVFVRDVLQHVDTIQKDYPDVPIFLLGHSMGGAISILVAAERPTYFSGMVLISPLVLANPESASTLKVLAAKLLNFVLPNMTLGRIDSSVLSRNKSEVDLYNSDPLVCRAGLKVCFGIQLLNAVARVERAMPRLTLPFLLLQGSADRLCDSKGAYLLMESSRSQDKTLKMYEGAYHVLHRELPEVTNSVLHEVNSWVSHRIAAAGAGCPP
• Purity: > 90% as determined by SDS-PAGE.
• Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
• Concentration: A hardcopy of COA with reconstitution instruction is sent along with the products.

Gene Information

• Gene Name: Mgll monoglyceride lipase [ Mus musculus ]
• Official Symbol: MGLL
• Synonyms: MGLL; monoglyceride lipase; monoacylglycerol lipase; Mgl; Magl; AA589436
• Gene ID: 23945
• mRNA Refseq: NM_001166249
• Protein Refseq: NP_001159721
• UniProt ID: O35678