Recombinant Mouse MGLL Protein (1-303 aa), His-tagged
Cat.No. : | MGLL-2105M |
Product Overview : | Recombinant Mouse MGLL Protein (1-303 aa) is produced by Yeast expression system. This protein is fused with a 6xHis tag at the N-terminal. Research Area: Cardiovascular. Protein Description: Full Length. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | Yeast |
Tag : | His |
Protein Length : | 1-303 aa |
Description : | Converts monoacylglycerides to free fatty acids and glycerol. Hydrolyzes the endocannabinoid 2-arachidonoylglycerol, and thereby contributes to the regulation of endocannabinoid signaling, nociperception and perception of pain (PubMed:9341166, PubMed:17700715, PubMed:18096503, PubMed:19029917, PubMed:20729846). Regulates the levels of fatty acids that serve as signaling molecules and promote cancer cell migration, invasion and tumor growth (By similarity). |
Form : | Tris-based buffer,50% glycerol |
Molecular Mass : | 35.4 kDa |
AA Sequence : | MPEASSPRRTPQNVPYQDLPHLVNADGQYLFCRYWKPSGTPKALIFVSHGAGEHCGRYDELAHMLKGLDMLVFAHDHVGHGQSEGERMVVSDFQVFVRDVLQHVDTIQKDYPDVPIFLLGHSMGGAISILVAAERPTYFSGMVLISPLVLANPESASTLKVLAAKLLNFVLPNMTLGRIDSSVLSRNKSEVDLYNSDPLVCRAGLKVCFGIQLLNAVARVERAMPRLTLPFLLLQGSADRLCDSKGAYLLMESSRSQDKTLKMYEGAYHVLHRELPEVTNSVLHEVNSWVSHRIAAAGAGCPP |
Purity : | > 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA with reconstitution instruction is sent along with the products. |
Gene Name | Mgll monoglyceride lipase [ Mus musculus ] |
Official Symbol | MGLL |
Synonyms | MGLL; monoglyceride lipase; monoacylglycerol lipase; Mgl; Magl; AA589436; |
Gene ID | 23945 |
mRNA Refseq | NM_001166249 |
Protein Refseq | NP_001159721 |
UniProt ID | O35678 |
◆ Recombinant Proteins | ||
MGLL-1407H | Recombinant Human MGLL Protein, His (Fc)-Avi-tagged | +Inquiry |
MGLL-2006H | Recombinant Human MGLL Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
MGLL-3221H | Recombinant Human MGLL protein, GST-tagged | +Inquiry |
Mgll-4060M | Recombinant Mouse Mgll Protein, Myc/DDK-tagged | +Inquiry |
MGLL-2863H | Recombinant Human Monoglyceride Lipase, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
MGLL-4330HCL | Recombinant Human MGLL 293 Cell Lysate | +Inquiry |
MGLL-4331HCL | Recombinant Human MGLL 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All MGLL Products
Required fields are marked with *
My Review for All MGLL Products
Required fields are marked with *
0
Inquiry Basket