Recombinant Mouse Mbl2 protein(19-244aa), His-tagged

• Cat.No.: Mbl2-4928M
• Product Overview: Recombinant Mouse Mbl2 protein(Q3UEK1)(19-244aa), fused with N-terminal His tag, was expressed in E. coli.

Specification

• Source: E. coli
• Species: Mouse
• Tag: His
• Protein length: 19-244aa
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 29.9 kDa
• AASequence: ETLTEGVQNSCPVVTCSSPGLNGFPGKDGRDGAKGEKGEPGQGLRGLQGPPGKVGPTGPPGNPGLKGAVGPKGDRGDRAEFDTSEIDSEIAALRSELRALRNWVLFSLSEKVGKKYFVSSVKKMSLDRVKALCSEFQGSVATPRNAEENSAIQKVAKDIAYLGITDVRVEGSFEDLTGNRVRYTNWNDGEPNNTGDGEDCVVILGNGKWNDVPCSDSFLAICEFSD
• Purity: Greater than 85% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C.

Gene Information

• Gene Name: Mbl2 mannose-binding lectin (protein C) 2 [ Mus musculus ]
• Official Symbol: Mbl2
• Synonyms: MBL2; mannose-binding lectin (protein C) 2; mannose-binding protein C; RARF/P28A; mannan-binding protein; mannose binding lectin (C); RA-reactive factor P28A subunit; mannose binding lectin, liver (C); MBL; L-MBP; MBL-C; MBP-C
• Gene ID: 17195
• mRNA Refseq: NM_010776
• Protein Refseq: NP_034906