Recombinant Mouse Lyve1 Protein, His-tagged

• Cat.No.: Lyve1-7148M
• Product Overview: Recombinant Mouse Lyve1 Protein (Met1-Gly228) fused to a C-terminal His tag (6×His) was expressed in insect cells.

Specification

• Species: Mouse
• Source: Insect Cells
• Tag: His
• Protein Length: 1-228 a.a.
• Description: Ligand-specific transporter trafficking between intracellular organelles (TGN) and the plasma membrane. Plays a role in autocrine regulation of cell growth mediated by growth regulators containing cell surface retention sequence binding (CRS). May act as a hyaluronan (HA) transporter, either mediating its uptake for catabolism within lymphatic endothelial cells themselves, or its transport into the lumen of afferent lymphatic vessels for subsequent re-uptake and degradation in lymph nodes.
• Predicted N Terminal: Ala24
• Form: Lyophilized
• Molecular Mass: 45 kDa
• AA Sequence: ADLVQDLSISTCRIMGVALVGRNKNPQMNFTEANEACKMLGLTLASRDQVESAQKSGFETCSYGWVGEQFSVIPRIFSNPRCGKNGKGVLIWNAPSSQKFKAYCHNSSDTWVNSCIPEIVTTFYPVLDTQTPATEFSVSSSAYLASSPDSTTPVSATTRAPPLTSMARKTKKICITEVYTEPITMATETEAFVASGAAFKNEAAGHHHHHH
• N-terminal Sequence Analysis: ADLVQDLS
• Endotoxin: < 0.1 ng/μg of VEGF-C
• Purity: > 95 % by SDS-PAGE and visualised by silver stain
• Stability: Shelf life: one year from despatch.
• Storage: Store lyophilized at 2-8 centigrade for 6 months or at -20 centigrade long term.
  After reconstitution store the antibody undiluted at 2-8 centigrade for one month or (in aliquots) at -20 centigrade long term.
  Avoid repeated freezing and thawing.
• Storage Buffer: PBS
• Reconstitution: Lyophilized sLYVE-1 is soluble in water and most aqueous buffers. The lyophilised sLYVE-1 should be reconstituted in PBS or medium to a concentration not lower than 50 μg/mL.

Gene Information

• Gene Name: Lyve1 lymphatic vessel endothelial hyaluronan receptor 1 [ Mus musculus (house mouse) ]
• Official Symbol: Lyve1
• Synonyms: Lyve1; lymphatic vessel endothelial hyaluronan receptor 1; Lyve; Xlkd; Xlkd1; Lyve-1; Crsbp-1; 1200012G08Rik; lymphatic vessel endothelial hyaluronic acid receptor 1; cell surface retention sequence binding protein-1; extra cellular link domain-containing 1; extracellular link domain-containing protein 1; lymphatic vessel endothelial HA receptor-1; lymphatic vessel endothelial HA recptor-1
• Gene ID: 114332
• mRNA Refseq: NM_053247
• Protein Refseq: NP_444477
• UniProt ID: Q8BHC0