Recombinant Mouse Ly6g6d protein, His-tagged
Cat.No. : | Ly6g6d-4533M |
Product Overview : | Recombinant Mouse Ly6g6d protein(Q9Z1Q3)(20-108aa), fused with N-terminal His tag, was expressed in Yeast. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | Yeast |
Tag : | His |
Protein Length : | 20-108aa |
Tag : | N-His |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Bio-activity : | Measured by its binding ability in a functional ELISA. Immobilized Mouse Ly6g6d at 2 μg/mL can bind Anti-LY6G6D recombinant antibody. The EC50 is 1.159-2.305 μg/mL. |
Molecular Mass : | 11.1 kDa |
Purity : | Greater than 95% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
AA Sequence : | HRTRCYDCGGGPSNSCKQTVITCGEGERCGFLDRKPQPSSEQAKQPSATLSHHYPACVATHHCNQVAIESVGDVTFTTQKNCCFGDLCN |
◆ Recombinant Proteins | ||
Ly6g6d-4533M | Recombinant Mouse Ly6g6d protein, His-tagged | +Inquiry |
LY6G6D-3509R | Recombinant Rat LY6G6D Protein | +Inquiry |
LY6G6D-1449H | Recombinant Human LY6G6D Protein (20-104 aa), His-tagged | +Inquiry |
LY6G6D-9373M | Recombinant Mouse LY6G6D Protein | +Inquiry |
LY6G6D-5255M | Recombinant Mouse LY6G6D Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
LY6G6D-4599HCL | Recombinant Human LY6G6D 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Ly6g6d Products
Required fields are marked with *
My Review for All Ly6g6d Products
Required fields are marked with *
0
Inquiry Basket