Recombinant Mouse LY6G Protein (4-96 aa), His-tagged
| Cat.No. : | LY6G-2281M |
| Product Overview : | Recombinant Mouse LY6G Protein (4-96 aa) is produced by Yeast expression system. This protein is fused with a 6xHis tag at the N-terminal. Protein Description: Full Length of Mature Protein. |
- Specification
- Gene Information
- Related Products
- Download
| Source : | Yeast |
| Species : | Mouse |
| Tag : | His |
| Form : | Tris-based buffer,50% glycerol |
| Molecular Mass : | 11.9 kDa |
| Protein length : | 4-96 aa |
| AA Sequence : | LECYNCIGVPPETSCNTTTCPFSDGFCVALEIEVIVDSHRSKVKSNLCLPICPTTLDNTEITGNAVNVKTYCCKEDLCNAAVPTGGSSWTMAG |
| Purity : | > 90% as determined by SDS-PAGE. |
| Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
| Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
| Concentration : | A hardcopy of COA will be sent along with the products. Please refer to it for detailed information. |
| Gene Name | Ly6g lymphocyte antigen 6 complex, locus G [ Mus musculus ] |
| Official Symbol | LY6G |
| Synonyms | LY6G; lymphocyte antigen 6 complex, locus G; Gr1; Gr-1; Ly-6G; |
| Gene ID | 17072 |
| UniProt ID | P35461 |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All LY6G Products
Required fields are marked with *
My Review for All LY6G Products
Required fields are marked with *
0
Inquiry Basket
