Recombinant Mouse Lxn Protein, His-tagged
| Cat.No. : | Lxn-7273M |
| Product Overview : | Recombinant mouse Lxn, fused to His-tag at N-terminus, was expressed in E. coli and purified by using conventional chromatography techniques. |
- Specification
- Gene Information
- Related Products
- Download
| Description : | Hardly reversible, non-competitive, and potent inhibitor of CPA1, CPA2 and CPA4. May play a role in inflammation. |
| Source : | E. coli |
| Species : | Mouse |
| Tag : | His |
| Form : | Liquid |
| Molecular Mass : | 27.9 kDa |
| Protein length : | 1-222 |
| AA Sequence : | MGSSHHHHHHSSGLVPRGSHMGSMEIPPTHYAASRAASVAENCINYQQGTPHKLFLVQTVQQASKEDIPGRGHKYHLKFSVEEIIQKQVTVNCTAEVLYPQMGQGSAPEVNFTFEGEIGKNPDEEDNTFYQSLMSLKRPLEAQDIPDNFGNVSPQMKPVQHLAWVACGYVMWQNSTEDTWYKMLKIQTVKQVQRNDDFIELDYTILLHDIASQEIIPWQMQVLWHPQYGTKVKHNSRLPKEGQAE |
| Purity : | > 95 % by SDS-PAGE |
| Stability : | Shelf life: one year from despatch. |
| Storage : | Store undiluted at 2-8 centigrade for one week or (in aliquots) at -20 to -80 centigrade for longer. Avoid repeated freezing and thawing. |
| Concentration : | 1.0 mg/mL (determined by absorbance at 280nm) |
| Storage Buffer : | Phosphate Buffer Saline (pH 7.4) containing 30 % glycerol, 1 mM DTT. |
| Gene Name | Lxn latexin [ Mus musculus (house mouse) ] |
| Official Symbol | Lxn |
| Synonyms | Lxn; latexin; latexin; ECI; TCI; endogenous carboxypeptidase inhibitor; tissue carboxypeptidase inhibitor |
| Gene ID | 17035 |
| mRNA Refseq | NM_016753 |
| Protein Refseq | NP_058033 |
| UniProt ID | P70202 |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Lxn Products
Required fields are marked with *
My Review for All Lxn Products
Required fields are marked with *
0
Inquiry Basket
