Recombinant Mouse Lilrb4 Protein, His-tagged
Cat.No. : | Lilrb4-362M |
Product Overview : | Recombinant Mouse Lilrb4 protein with His tag was expressed in HEK293. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | HEK293 |
Tag : | His |
Protein Length : | 335 |
Description : | Enables integrin binding activity. Involved in negative regulation of mast cell activation involved in immune response. Acts upstream of or within several processes, including alpha-beta T cell proliferation; cellular response to lipopolysaccharide; and response to nematode. Located in external side of plasma membrane. Is expressed in urinary system. Orthologous to human LILRB4 (leukocyte immunoglobulin like receptor B4). |
Form : | Lyophilized |
Molecular Mass : | 26 kDa |
AA Sequence : | MIAMLTVLLYLGLILEPRTAVQAGHLPKPIIWAEPGSVIAAYTSVITWCQGSWEAQYYHLYKEKSVNPWDTQVPLETRNKAKFNIPSMTTSYAGIYKCYYESAAGFSEHSDAMELVMTGAYENPSLSVYPSSNVTSGVSISFSCSSSIVFGRFILIQEGKHGLSWTLDSQHQANQPSYATFVLDAVTPNHNGTFRCYGYFRNEPQVWSKPSNSLDLMISETKDQSSTPTEDGLETYQKILIGVLVSFLLLFFLLLFLILIGYQYGHKKKANASVKNTQSENNAELNSWNPQNEDPQGIVYAQVKPSRLQKDTACKETQDVTYAQLCIRTQEQNNS |
Purity : | > 98% |
Applications : | WB; ELISA; FACS; FC |
Stability : | This bioreagent is stable at 4 centigrade (short-term) and -70 centigrade(long-term). After reconstitution, sample may be stored at 4 centigrade for 2-7 days and below -18 centigrade for future use. |
Storage : | At -20 centigrade. |
Concentration : | 1 mg/mL |
Storage Buffer : | PBS (pH 7.4-7.5). Sterile-filtered colorless solution. |
Reconstitution : | Reconstitute in sterile distilled H2O to no less than 100 μg/mL; dilute reconstituted stock further in other aqueous solutions if needed. Please review COA for lot-specific instructions. Final measurements should be determined by the end-user for optimal performance. |
Gene Name | Lilrb4 leukocyte immunoglobulin-like receptor, subfamily B, member 4 [ Mus musculus (house mouse) ] |
Official Symbol | Lilrb4 |
Synonyms | HM18; ILT3; gp49; CD85K; Gp49b; LIR-5 |
Gene ID | 14728 |
mRNA Refseq | NM_013532 |
Protein Refseq | NP_038560 |
UniProt ID | Q64281 |
◆ Recombinant Proteins | ||
LILRB4-9101M | Recombinant Mouse LILRB4 Protein | +Inquiry |
LILRB4-1583H | Recombinant Human LILRB4 protein, His-Avi-tagged | +Inquiry |
LILRB4-5743H | Recombinant Human LILRB4 protein, His-Avi-tagged | +Inquiry |
LILRB4-1381H | Recombinant Human LILRB4 protein, His-Avi-tagged | +Inquiry |
Lilrb4-362M | Recombinant Mouse Lilrb4 Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
LILRB4-380HCL | Recombinant Human LILRB4 lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Lilrb4 Products
Required fields are marked with *
My Review for All Lilrb4 Products
Required fields are marked with *
0
Inquiry Basket