Recombinant Mouse Lgals2 Protein, His-tagged
Cat.No. : | Lgals2-7143M |
Product Overview : | Recombinant Mouse Lgals2 protein, fused to His-tag at N-terminus, was expressed in E. coli and purified by using conventional chromatography techniques. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | E.coli |
Tag : | His |
Protein Length : | 1-130 |
Description : | This protein binds beta-galactoside. Its physiological function is not yet known. |
Form : | Liquid |
Molecular Mass : | 17.3 kDa |
AA Sequence : | MGSSHHHHHHSSGLVPRGSHMGSMSEKFEVKDLNMKPGMSLKIKGKIHNDVDRFLINLGQGKETLNLHFNPRFDESTIVCNTSEGGRWGQEQRENHMCFSPGSEVKITITFQDKDFKVTLPDGHQLTFPNRLGHNQLHYLSMGGLQISSFKLE |
Purity : | > 95 % by SDS-PAGE |
Stability : | Shelf life: one year from despatch. |
Storage : | Store undiluted at 2-8 centigrade for one week or (in aliquots) at -20 to -80 centigrade for longer. Avoid repeated freezing and thawing. |
Concentration : | 1.0 mg/mL (determined by Bradford assay) |
Storage Buffer : | 20 mM Tris-HCl buffer (pH 8.0) containing 0.1 M NaCl, 10 % glycerol,1 mM DTT |
Gene Name | Lgals2 lectin, galactose-binding, soluble 2 [ Mus musculus (house mouse) ] |
Official Symbol | Lgals2 |
Synonyms | Lgals2; lectin, galactose-binding, soluble 2; AI324147; 2200008F12Rik; galectin-2; gal-2 |
Gene ID | 107753 |
mRNA Refseq | NM_025622 |
Protein Refseq | NP_079898 |
UniProt ID | Q9CQW5 |
◆ Recombinant Proteins | ||
Lgals2-405M | Recombinant Mouse Lgals2 Protein, His-tagged | +Inquiry |
LGALS2-406P | Recombinant Pig LGALS2 Protein, His-tagged | +Inquiry |
LGALS2-9062M | Recombinant Mouse LGALS2 Protein | +Inquiry |
LGALS2-3165H | Recombinant Human LGALS2 protein, GST-tagged | +Inquiry |
Lgals2-7140M | Active Recombinant Mouse Lgals2 Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
LGALS2-4767HCL | Recombinant Human LGALS2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Lgals2 Products
Required fields are marked with *
My Review for All Lgals2 Products
Required fields are marked with *
0
Inquiry Basket