Recombinant Mouse KLRD1 Protein, His-tagged

• Cat.No.: KLRD1-66M
• Product Overview: Recombinant Mouse KLRD1 Protein, fused to His-tag, was expressed in HEK293.

Specification

• Species: Mouse
• Source: HEK293
• Tag: His
• Description: Predicted to enable HLA-E specific inhibitory MHC class Ib receptor activity; MHC protein complex binding activity; and protein antigen binding activity. Predicted to be involved in natural killer cell mediated immunity; regulation of leukocyte mediated cytotoxicity; and stimulatory C-type lectin receptor signaling pathway. Predicted to act upstream of or within adaptive immune response and innate immune response. Located in external side of plasma membrane. Orthologous to human KLRD1 (killer cell lectin like receptor D1).
• Form: PBS, pH 7.4.
• Molecular Mass: 18.1 kDa
• AA Sequence: INSFTIQNIQSTPSPTTTVEFQEVSECCVCLDKWVGHQCNCYFISKEEKSWKRSRDFCASQNSSLLQPQSRNELSFMNFSQTFFWIGMHYSEKRNAWLWEDGTVPSKDLFPEFSVIRPEHCIVYSPSKSVSAESCENKNRYICKKLPIHHHHHH
• Endotoxin: < 1.0 EU/μg of the protein as determined by the LAL method.
• Purity: >90%
• Storage: Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
• Concentration: 0.1 mg/ml

Gene Information

• Gene Name: Klrd1 killer cell lectin-like receptor, subfamily D, member 1 [ Mus musculus (house mouse) ]
• Official Symbol: KLRD1
• Synonyms: CD94
• Gene ID: 16643
• mRNA Refseq: NM_010654
• Protein Refseq: NP_034784
• UniProt ID: O54707