Recombinant Mouse KLRA3 Protein (70-266 aa), His-tagged

Cat.No. : KLRA3-2466M
Product Overview : Recombinant Mouse KLRA3 Protein (70-266 aa) is produced by E. coli expression system. This protein is fused with a 6xHis tag at the N-terminal. Protein Description: Partial.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Mouse
Source : E.coli
Tag : His
Protein Length : 70-266 aa
Description : Receptor on natural killer (NK) cells for class I MHC.
Form : Tris-based buffer,50% glycerol
Molecular Mass : 27.6 kDa
AA Sequence : QYNQHKQEINETLNHHHNCSNMQRAFNLKEEMLTNKSIDCRPSNETLEYIKREQDRWDSKTKTVLDSSRDTGRGVKYWFCYSTKCYYFIMNKTTWSGCKANCQHYSVPILKIEDEDELKFLQRHVIPENYWIGLSYDKKKKEWAWIDNGPSKLDMKIRKMNFKSRGCVFLSKARIEDIDCNIPYYCICGKKLDKFPD
Purity : > 85% as determined by SDS-PAGE.
Notes : Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
Storage : The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
Concentration : A hardcopy of COA will be sent along with the products. Please refer to it for detailed information.
Gene Name Klra3 killer cell lectin-like receptor, subfamily A, member 3 [ Mus musculus ]
Official Symbol KLRA3
Synonyms KLRA3; lymphocyte antigen 49c; 5E6; Nk2; Nk-2; Ly49c; Nk2.1; NK-2.1; MGC123910;
Gene ID 16634
mRNA Refseq NM_010648
Protein Refseq NP_034778
UniProt ID Q64329

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All KLRA3 Products

Required fields are marked with *

My Review for All KLRA3 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon