Recombinant Mouse KLRA3 Protein (70-266 aa), His-tagged

• Cat.No.: KLRA3-2466M
• Product Overview: Recombinant Mouse KLRA3 Protein (70-266 aa) is produced by E. coli expression system. This protein is fused with a 6xHis tag at the N-terminal. Protein Description: Partial.

Specification

• Description: Receptor on natural killer (NK) cells for class I MHC.
• Source: E. coli
• Species: Mouse
• Tag: His
• Form: Tris-based buffer,50% glycerol
• Molecular Mass: 27.6 kDa
• Protein length: 70-266 aa
• AA Sequence: QYNQHKQEINETLNHHHNCSNMQRAFNLKEEMLTNKSIDCRPSNETLEYIKREQDRWDSKTKTVLDSSRDTGRGVKYWFCYSTKCYYFIMNKTTWSGCKANCQHYSVPILKIEDEDELKFLQRHVIPENYWIGLSYDKKKKEWAWIDNGPSKLDMKIRKMNFKSRGCVFLSKARIEDIDCNIPYYCICGKKLDKFPD
• Purity: > 85% as determined by SDS-PAGE.
• Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
• Concentration: A hardcopy of COA will be sent along with the products. Please refer to it for detailed information.

Gene Information

• Gene Name: Klra3 killer cell lectin-like receptor, subfamily A, member 3 [ Mus musculus ]
• Official Symbol: KLRA3
• Synonyms: KLRA3; lymphocyte antigen 49c; 5E6; Nk2; Nk-2; Ly49c; Nk2.1; NK-2.1; MGC123910
• Gene ID: 16634
• mRNA Refseq: NM_010648
• Protein Refseq: NP_034778
• UniProt ID: Q64329