Recombinant Mouse Klk1b22 Protein, His-tagged

• Cat.No.: Klk1b22-339M
• Product Overview: Recombinant Mouse Klk1b22 protein with His tag was expressed in HEK293.

Specification

• Species: Mouse
• Source: HEK293
• Tag: His
• Protein Length: 259
• Description: This gene encodes the beta subunit of the 7S nerve growth factor (NGF) complex that is essential for the differentiation and survival of distinct populations of neurons in both the central and the peripheral nervous systems. The encoded preproprotein undergoes proteolytic processing to generate a functional, mature peptide. This gene is located in a cluster of several related kallikrein genes on chromosome 7.
• Form: Lyophilized
• Molecular Mass: 27.3 kDa
• AA Sequence: MRFLILFLTLSLGGIDAAPPVQSRILGGFKCEKNSQPWQVAVYYLDEYLCGGVLLDRNWVLTAAHCYEDKYNIWLGKNKLFQDEPSAQHRLVSKSFPHPDFNMSLLQSVPTGADLSNDLMLLRLSKPADITDVVKPIDLPTTEPKLGSTCLASGWGSINQLIYQNPNDLQCVSIKLHPNEVCVKAHILKVTDVMLCAGEMNGGKDTCKGDSGGPLICDGVLQGITSWGSTPCGEPNAPAIYTKLIKFTSWIKDTMAKNP
• Purity: > 98%
• Applications: WB; ELISA; FACS; FC
• Stability: This bioreagent is stable at 4 centigrade (short-term) and -70 centigrade(long-term). After reconstitution, sample may be stored at 4 centigrade for 2-7 days and below -18 centigrade for future use.
• Storage: At -20 centigrade.
• Concentration: 1 mg/mL
• Storage Buffer: PBS (pH 7.4-7.5). Sterile-filtered colorless solution.
• Reconstitution: Reconstitute in sterile distilled H2O to no less than 100 μg/mL; dilute reconstituted stock further in other aqueous solutions if needed. Please review COA for lot-specific instructions. Final measurements should be determined by the end-user for optimal performance.
• Publications:
  Serendipitous Discovery of T Cell–Produced KLK1b22 as a Regulator of Systemic Metabolism (2023)

Gene Information

• Gene Name: Klk1b22 kallikrein 1-related peptidase b22 [ Mus musculus (house mouse) ]
• Official Symbol: Klk1b22
• Synonyms: Klk1b22; kallikrein 1-related peptidase b22; Klk22; Egfbp1; mGk-22; Egfbp-1; EGF-BP A; kallikrein 1-related peptidase b22; beta-NGF-endopeptidase; epidermal growth factor-binding protein type A; glandular kallikrein K22; nerve growth factor beta chain endopeptidase; tissue kallikrein 22; EC 3.4.21.35
• Gene ID: 13646
• mRNA Refseq: NM_010114
• Protein Refseq: NP_034244
• UniProt ID: P15948