Recombinant Mouse KIF1A Protein (1-361 aa), His-SUMO-tagged

• Cat.No.: KIF1A-599M
• Product Overview: Recombinant Mouse KIF1A Protein (1-361 aa) is produced by E. coli expression system. This protein is fused with a 6xHis-SUMO tag at the N-terminal. Protein Description: Partial.

Specification

• Species: Mouse
• Source: E.coli
• Tag: His&SUMO
• Protein Length: 1-361 aa
• Description: Motor for anterograde axonal transport of synaptic vesicle precursors.
• Form: Tris-based buffer, 50% glycerol
• Molecular Mass: 56.4 kDa
• AA Sequence: MAGASVKVAVRVRPFNSREMSRDSKCIIQMSGSTTTIVNPKQPKETPKSFSFDYSYWSHTSPEDINYASQKQVYRDIGEEMLQHAFEGYNVCIFAYGQTGAGKSYTMMGKQEKDQQGIIPQLCEDLFSRINDTTNDNMSYSVEVSYMEIYCERVRDLLNPKNKGNLRVREHPLLGPYVEDLSKLAVTSYNDIQDLMDSGNKPRTVAATNMNETSSRSHAVFNIIFTQKRHDAETNITTEKVSKISLVDLAGSERADSTGAKGTRLKEGANINKSLTTLGKVISALAEMDSGPNKNKKKKKTDFIPYRDSVLTWLLRENLGGNSRTAMVAALSPADINYDETLSTLRYADRAKQIRCNAIIN
• Purity: > 90% as determined by SDS-PAGE.
• Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
• Concentration: A hardcopy of COA with concentration instruction is sent along with the products.

Gene Information

• Gene Name: Kif1a kinesin family member 1A [ Mus musculus ]
• Official Symbol: KIF1A
• Synonyms: KIF1A; ATSV; Kns1; Gm1626; C630002N23Rik
• Gene ID: 16560
• mRNA Refseq: NM_001110315
• Protein Refseq: NP_001103785
• UniProt ID: P33173