Recombinant Mouse Jag1 Protein, His-Sumo/MYC-tagged
Cat.No. : | Jag1-1264M |
Product Overview : | Recombinant Mouse Jag1 protein (33-334aa) was expressed in E. coli with N-terminal His-SUMO tag and C-terminal MYC tag. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | E.coli |
Tag : | His&Myc&SUMO |
ProteinLength : | 33-334 a.a. |
Form : | Tris-based buffer, 50% glycerol. |
Molecular Mass : | 53.6 kDa |
AA Sequence : | GQFELEILSMQNVNGELQNGNCCGGVRNPGDRKCTRDECDTYFKVCLKEYQSRVTAGGPCSFGSGSTPVIGGNTFNLKASRGNDRNRIVLPFSFAWPRSYTLLVEAWDSSNDTIQPDSIIEKASHSGMINPSRQWQTLKQNTGIAHFEYQIRVTCDDHYYGFGCNKFCRPRDDFFGHYACDQNGNKTCMEGWMGPDCNKAICRQGCSPKHGSCKLPGDCRCQYGWQGLYCDKCIPHPGCVHGTCNEPWQCLCETNWGGQLCDKDLNYCGTHQPCLNRGTCSNTGPDKYQCSCPEGYSGPNCE |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | The shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Gene Name | Jag1 jagged 1 [ Mus musculus (house mouse) ] |
Official Symbol | Jag1 |
Synonyms | Htu; Ozz; ABE2; Ser-1; Gsfabe2; Jag1 |
Gene ID | 16449 |
mRNA Refseq | NM_013822.5 |
Protein Refseq | NP_038850.1 |
UniProt ID | Q9QXX0 |
◆ Native Proteins | ||
Skin-008H | Human Skin Lysate, Total Protein | +Inquiry |
Complement C4-50H | Native Human Complement C4 | +Inquiry |
SC5b9-1438H | Native Human SC5b-9 Complex Protein | +Inquiry |
ATF-177D | Native Dog Apotransferrin | +Inquiry |
Collagen Type I-04H | Native Human Collagen Type I | +Inquiry |
◆ Cell & Tissue Lysates | ||
DDR1-1081RCL | Recombinant Rat DDR1 cell lysate | +Inquiry |
CCL25-7726HCL | Recombinant Human CCL25 293 Cell Lysate | +Inquiry |
DAPL1-7075HCL | Recombinant Human DAPL1 293 Cell Lysate | +Inquiry |
FSIP1-6130HCL | Recombinant Human FSIP1 293 Cell Lysate | +Inquiry |
KPTN-4886HCL | Recombinant Human KPTN 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Jag1 Products
Required fields are marked with *
My Review for All Jag1 Products
Required fields are marked with *
0
Inquiry Basket