Recombinant Mouse Jag1 Protein, His-Sumo/MYC-tagged

Cat.No. : Jag1-1264M
Product Overview : Recombinant Mouse Jag1 protein (33-334aa) was expressed in E. coli with N-terminal His-SUMO tag and C-terminal MYC tag.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Mouse
Source : E.coli
Tag : His&Myc&SUMO
ProteinLength : 33-334 a.a.
Form : Tris-based buffer, 50% glycerol.
Molecular Mass : 53.6 kDa
AA Sequence : GQFELEILSMQNVNGELQNGNCCGGVRNPGDRKCTRDECDTYFKVCLKEYQSRVTAGGPCSFGSGSTPVIGGNTFNLKASRGNDRNRIVLPFSFAWPRSYTLLVEAWDSSNDTIQPDSIIEKASHSGMINPSRQWQTLKQNTGIAHFEYQIRVTCDDHYYGFGCNKFCRPRDDFFGHYACDQNGNKTCMEGWMGPDCNKAICRQGCSPKHGSCKLPGDCRCQYGWQGLYCDKCIPHPGCVHGTCNEPWQCLCETNWGGQLCDKDLNYCGTHQPCLNRGTCSNTGPDKYQCSCPEGYSGPNCE
Purity : Greater than 90% as determined by SDS-PAGE.
Storage : The shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
Gene Name Jag1 jagged 1 [ Mus musculus (house mouse) ]
Official Symbol Jag1
Synonyms Htu; Ozz; ABE2; Ser-1; Gsfabe2; Jag1
Gene ID 16449
mRNA Refseq NM_013822.5
Protein Refseq NP_038850.1
UniProt ID Q9QXX0

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All Jag1 Products

Required fields are marked with *

My Review for All Jag1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon