Recombinant Mouse Jag1 Protein, His-Sumo/MYC-tagged
Cat.No. : | Jag1-1264M |
Product Overview : | Recombinant Mouse Jag1 protein (33-334aa) was expressed in E. coli with N-terminal His-SUMO tag and C-terminal MYC tag. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | E.coli |
Tag : | His&Myc&SUMO |
Protein Length : | 33-334 a.a. |
Form : | Tris-based buffer, 50% glycerol. |
Molecular Mass : | 53.6 kDa |
AA Sequence : | GQFELEILSMQNVNGELQNGNCCGGVRNPGDRKCTRDECDTYFKVCLKEYQSRVTAGGPCSFGSGSTPVIGGNTFNLKASRGNDRNRIVLPFSFAWPRSYTLLVEAWDSSNDTIQPDSIIEKASHSGMINPSRQWQTLKQNTGIAHFEYQIRVTCDDHYYGFGCNKFCRPRDDFFGHYACDQNGNKTCMEGWMGPDCNKAICRQGCSPKHGSCKLPGDCRCQYGWQGLYCDKCIPHPGCVHGTCNEPWQCLCETNWGGQLCDKDLNYCGTHQPCLNRGTCSNTGPDKYQCSCPEGYSGPNCE |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | The shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Gene Name | Jag1 jagged 1 [ Mus musculus (house mouse) ] |
Official Symbol | Jag1 |
Synonyms | Htu; Ozz; ABE2; Ser-1; Gsfabe2; Jag1 |
Gene ID | 16449 |
mRNA Refseq | NM_013822.5 |
Protein Refseq | NP_038850.1 |
UniProt ID | Q9QXX0 |
◆ Recombinant Proteins | ||
JAG1-566H | Recombinant Human JAG1 | +Inquiry |
JAG1-3134R | Recombinant Rat JAG1 Protein | +Inquiry |
AMBN-7443H | Recombinant Human AMBN protein, GST-tagged | +Inquiry |
JAG1-792H | Recombinant Human JAG1 Protein, MYC/DDK-tagged | +Inquiry |
JAG1-5856H | Recombinant Human JAG1 protein, hFc-Myc-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
JAG1-2382HCL | Recombinant Human JAG1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Jag1 Products
Required fields are marked with *
My Review for All Jag1 Products
Required fields are marked with *
0
Inquiry Basket