Recombinant Mouse ITGAL Protein (153-325 aa), His-tagged
Cat.No. : | ITGAL-1426M |
Product Overview : | Recombinant Mouse ITGAL Protein (153-325 aa) is produced by Yeast expression system. This protein is fused with a 6xHis tag at the N-terminal. Protein Description: Partial. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | Yeast |
Tag : | His |
Protein Length : | 153-325 aa |
Description : | Integrin alpha-L/beta-2 is a receptor for ICAM1, ICAM2, ICAM3 and ICAM4. Is involved in a variety of immune phenomena including leukocyte-endothelial cell interaction, cytotoxic T-cell mediated killing, and antibody dependent killing by granulocytes and monocytes. Mice expressing a null mutation of the alpha-L subunit gene donstrate impaired tumor rejection and impaired leukocytes recruitment. |
Form : | Tris-based buffer,50% glycerol |
Molecular Mass : | 21.7 kDa |
AA Sequence : | DLVFLFDGSQSLDRKDFEKILEFMKDVMRKLSNTSYQFAAVQFSTDCRTEFTFLDYVKQNKNPDVLLGSVQPMFLLTNTFRAINYVVAHVFKEESGARPDATKVLVIITDGEASDKGNISAAHDITRYIIGIGKHFVSVQKQKTLHIFASEPVEEFVKILDTFEKLKDLFTDL |
Purity : | > 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA with reconstitution instruction is sent along with the products. |
Gene Name | Itgal integrin alpha L [ Mus musculus ] |
Official Symbol | ITGAL |
Synonyms | ITGAL; Cd11a; LFA-1; Ly-15; Ly-21; (p180); LFA-1A; |
Gene ID | 16408 |
mRNA Refseq | NM_001253872 |
Protein Refseq | NP_001240801 |
UniProt ID | P24063 |
◆ Recombinant Proteins | ||
Itgal-7135R | Recombinant Rat Itgal protein, His & T7-tagged | +Inquiry |
ITGAL-168HFL | Active Recombinant Full Length Human ITGAL Protein, C-Flag-tagged | +Inquiry |
ITGAL-754H | Recombinant Human ITGAL protein, His-tagged | +Inquiry |
ITGAL-589M | Recombinant Mouse ITGAL Protein (153-325 aa), His-tagged | +Inquiry |
ITGAL-2092H | Recombinant Human ITGAL Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
◆ Cell & Tissue Lysates | ||
ITGAL-5129HCL | Recombinant Human ITGAL 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ITGAL Products
Required fields are marked with *
My Review for All ITGAL Products
Required fields are marked with *
0
Inquiry Basket