Recombinant Mouse Interleukin 12 Protein, His tagged

• Cat.No.: IL12-21M
• Product Overview: Recombinant mouse IL12b/IL12a protein, fused to His-tag at C-terminus, was expressed in insect cell and purified by using conventional chromatography techniques.

Specification

• Species: Mouse
• Source: Baculovirus
• Tag: His
• Protein Length: 23-335aa(p40)/23-215aa(p35)
• Description: IL12b/IL12a, also known as interleukin 12 (subunit beta/alpha), is a cytokine that can act as a growth factor for activated T and NK cells, enhance the lytic activity of NK/lymphokine-activated killer cells, and stimulate the production of IFN-gamma by resting PBMC. It is a key mediator of cellular-immunity and induces the differentiation of Th1 cells from precursor T helper cells. As it is associated with IL23A to form the IL-23 interleukin, it induces autoimmune inflammation and is responsible for autoimmune inflammatory diseases and may be important for tumorigenesis.
• Tag: C-His
• Form: Liquid
• Bio-activity: The activity is determined by the IFN-g ELISA in a using NK-92 human natural killer cells. The ED50 for this effect is less or equal to 10 ng/mL.
• Molecular Mass: 58.3 kDa
• AA Sequence: IL12B (p40): MWELEKDVYVVEVDWTPDAPGETVNLTCDTPEEDDITWTSDQRHGVIGSGKTLTITVKEFLDAGQYTCHKGGETLSHSHLLLHKKENGIWSTEILKNFKNKTFLKCEAPNYSGRFTCSWLVQRNMDLKFNIKSSSSSPDSRAVTCGMASLSAEKVTLDQRDYEKYSVSCQEDVTCPTAEETLPIELALEARQQNKYENYSTSFFIRDIIKPDPPKNLQMKPLKNSQVEVSWEYPDSWSTPHSYFSLKFFVRIQRKKEKMKETEEGCNQKGAFLVEKTSTEVQCKGGNVCVQAQDRYYNSSCSKWACVPCRVRS
  IL12A (p35): RVIPVSGPARCLSQSRNLLKTTDDMVKTAREKLKHYSCTAEDIDHEDITRDQTSTLKTCLPLELHKNESCLATRETSSTTRGSCLPPQKTSLMMTLCLGSIYEDLKMYQTEFQAINAALQNHNHQQIILDKGMLVAIDELMQSLNHNGETLRQKPPVGEADPYRVKMKLCILLHAFSTRVVTINRVMGYLSSA
• Endotoxin: < 1 EU/μg, determined by LAL method.
• Purity: > 95% by SDS-PAGE
• Applications: SDS-PAGE, Bioactivity
• Storage: Can be stored at +2 to +8 centigrade for 1 week. For long term storage, aliquot and store at -20 to -80 centigrade. Avoid repeated freezing and thawing cycles.
• Concentration: 0.5 mg/mL (determined by Bradford assay)
• Storage Buffer: Phosphate-Buffered Saline (pH 7.4) containing 10% glycerol
• Notes: For research use only. This product is not intended or approved for human, diagnostics or veterinary use.
• GeneID 2: 16159
• References: 1. Zhang X., et al, (2015) J Immunol. 195:1665-1675.
  2. Zamani A., et al, (2017) Immune Netw. 17:186-191.

Gene Information

• Gene Name: Il12b interleukin 12b [ Mus musculus (house mouse) ]
• Official Symbol: IL12B
• Synonyms: IL12B; interleukin 12b; interleukin-12 subunit beta; CLMF p40; IL-12 p40; IL-12 subunit p40; IL-23 subunit p40; cytotoxic lymphocyte maturation factor 40 kDa subunit; p40; Il-12b; Il12p40; Il-12p40
• Gene ID: 16160
• mRNA Refseq: NM_001303244
• Protein Refseq: NP_001290173
• UniProt ID: P43432
• Gene Name 2: Il12a interleukin 12a [ Mus musculus (house mouse) ]
• Official Symbol 2: IL12A
• Synonyms 2: IL12A; interleukin 12a; interleukin-12 subunit alpha; CLMF p35; IL-12 subunit p35; interleukin 12a p35 subunit; cytotoxic lymphocyte maturation factor 35 kDa subunit; p35; Ll12a; Il-12a; IL-12p35; MGC151228; MGC151232
• mRNA Refseq 2: NM_008351
• Protein Refseq 2: NP_032377
• UniProt ID 2: P43431