Recombinant Mouse Il2rb protein, His-tagged

• Cat.No.: Il2rb-3101M
• Product Overview: Recombinant Mouse Il2rb protein(P16297)(24-240aa), fused to N-terminal His tag, was expressed in E. coli.

Specification

• Source: E. coli
• Species: Mouse
• Tag: His
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
  If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 29.3 kDa
• Protein length: 24-240aa
• AA Sequence: ASAAVKNCSHLECFYNSRANVSCMWSHEEALNVTTCHVHAKSNLRHWNKTCELTLVRQASWACNLILGSFPESQSLTSVDLLDINVVCWEEKGWRRVKTCDFHPFDNLRLVAPHSLQVLHIDTQRCNISWKVSQVSHYIEPYLEFEARRRLLGHSWEDASVLSLKQRQQWLFLEMLIPSTSYEVQVRVKAQRNNTGTWSPWSQPLTFRTRPADPMKE
• Purity: Greater than 90% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%.

Gene Information

• Gene Name: Il2rb interleukin 2 receptor, beta chain [ Mus musculus ]
• Official Symbol: Il2rb
• Synonyms: IL2RB; interleukin 2 receptor, beta chain; interleukin-2 receptor subunit beta; IL-2RB; p70-75; IL-2R subunit beta; IL-2/15 receptor-beta; IL-2 receptor beta chain; IL-15 receptor beta chain; IL-2 receptor subunit beta; high affinity IL-2 receptor subunit beta; p70; CD122; IL15Rbeta; Il-2Rbeta; IL-15Rbeta; Il-2/15Rbeta; MGC118674
• Gene ID: 16185
• mRNA Refseq: NM_008368
• Protein Refseq: NP_032394