Recombinant Human IL2RB, Fc-tagged
Cat.No. : | IL2RB-29776TH |
Product Overview : | Recombinant fragment, corresponding to amino acids 27-237 of Human IL2 Receptor beta fused to the Fc region of human IgG1 expressed in modified human 293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Tag : | Fc |
Protein Length : | 27-237 a.a. |
Description : | The interleukin 2 receptor, which is involved in T cell-mediated immune responses, is present in 3 forms with respect to ability to bind interleukin 2. The low affinity form is a monomer of the alpha subunit and is not involved in signal transduction. The intermediate affinity form consists of an alpha/beta subunit heterodimer, while the high affinity form consists of an alpha/beta/gamma subunit heterotrimer. Both the intermediate and high affinity forms of the receptor are involved in receptor-mediated endocytosis and transduction of mitogenic signals from interleukin 2. The protein encoded by this gene represents the beta subunit and is a type I membrane protein. |
Conjugation : | Fc |
Biological activity : | IL2RB-29776TH bound to protein A sepharose beads is able to pull down its ligand, IL2. |
Form : | Lyophilised:It is recommended that 0.5 ml of sterile phosphate-buffered saline be added to the vial.Following reconstitution short-term storage at 4°C is recommended, and longer-term storage of aliquots at -18 to -20°C. Repeated freeze thawing is not reco |
Purity : | >95% by SDS-PAGE |
Storage buffer : | Preservative: NoneConstituents: 10% Trehalose, 1% Human serum albumin |
Storage : | Store at +4°C. |
Sequences of amino acids : | Theoretical Sequence:AVNGTSQFTCFYNSRANISCVWSQDGALQ DTSCQVHAWPDRRRWNQTCELLPVSQASWACNLILGAP DSQKLTTVDIVTLRVLCREGVRWRVMAIQDFKPFENLR LMAPISLQVVHVETHRCNISWEISQASHYFERHLEFEARTLSPGHTWEEAPLLTLKQKQEWICLETLTPDTQYEFQVR VKPLQGEFTTWSPWSQPLAFRTKPAALGIPKVDKKVEP KSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISR TPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPRE EQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIE KTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKG FYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSK LTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK |
Gene Name | IL2RB interleukin 2 receptor, beta [ Homo sapiens ] |
Official Symbol | IL2RB |
Synonyms | IL2RB; interleukin 2 receptor, beta; IL15RB, interleukin 15 receptor, beta; interleukin-2 receptor subunit beta; CD122; |
Gene ID | 3560 |
mRNA Refseq | NM_000878 |
Protein Refseq | NP_000869 |
MIM | 146710 |
Uniprot ID | P14784 |
Chromosome Location | 22q13 |
Pathway | Cytokine Signaling in Immune system, organism-specific biosystem; Cytokine-cytokine receptor interaction, organism-specific biosystem; Cytokine-cytokine receptor interaction, conserved biosystem; Downstream signaling in naive CD8+ T cells, organism-specific biosystem; Endocytosis, organism-specific biosystem; |
Function | interleukin-2 binding; interleukin-2 receptor activity; contributes_to interleukin-2 receptor activity; receptor activity; |
◆ Recombinant Proteins | ||
IL2RB-051H | Recombinant Human IL2RB protein, His-Avi-tagged, Biotinylated | +Inquiry |
IL2RB-1553R | Recombinant Rhesus Monkey IL2RB Protein | +Inquiry |
IL2RB-785H | Active Recombinant Human IL2RB protein, His&Twin-Strep-tagged | +Inquiry |
RFL8063HF | Recombinant Full Length Human Interleukin-2 Receptor Subunit Beta(Il2Rb) Protein, His-Tagged | +Inquiry |
IL2RB-2248R | Recombinant Rhesus monkey IL2RB Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
IL2RB-744MCL | Recombinant Mouse IL2RB cell lysate | +Inquiry |
IL2RB-741CCL | Recombinant Canine IL2RB cell lysate | +Inquiry |
IL2RB-2906HCL | Recombinant Human IL2RB cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All IL2RB Products
Required fields are marked with *
My Review for All IL2RB Products
Required fields are marked with *
0
Inquiry Basket