Recombinant Mouse IL2RB Protein, His-tagged

Cat.No. : IL2RB-1257M
Product Overview : Recombinant Mouse IL2RB Protein (27-240aa) was expressed in Yeast with N-terminal His-tag.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Mouse
Source : Yeast
Tag : His
Protein Length : 27-240 a.a.
Description : The interleukin 2 receptor is composed of alpha and beta subunits. The beta subunit encoded by this gene is very homologous to the human beta subunit and also shows structural similarity to other cytokine receptors.
Form : Tris-based buffer, 50% glycerol.
Molecular Mass : 27.0 kDa
AA Sequence : AVKNCSHLECFYNSRANVSCMWSHEEALNVTTCHVHAKSNLRHWNKTCELTLVRQASWACNLILGSFPES
QSLTSVDLLDINVVCWEEKGWRRVKTCDFHPFDNLRLVAPHSLQVLHIDTQRCNISWKVSQVSHYIEPYL
EFEARRRLLGHSWEDASVLSLKQRQQWLFLEMLIPSTSYEVQVRVKAQRNNTGTWSPWSQPLTFRTRPAD
PMKE
Purity : Greater than 90% as determined by SDS-PAGE.
Storage : The shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
Gene Name Il2rb interleukin 2 receptor, beta chain [ Mus musculus (house mouse) ]
Official Symbol IL2RB
Synonyms p70; CD122; IL15Rbeta; Il-2Rbeta; IL-15Rbeta; Il-2/15Rbeta
Gene ID 16185
mRNA Refseq NM_008368.4
Protein Refseq NP_032394.1
UniProt ID P16297

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All IL2RB Products

Required fields are marked with *

My Review for All IL2RB Products

Required fields are marked with *

0

Inquiry Basket

cartIcon