Recombinant Mouse IL2RB Protein, His-tagged

• Cat.No.: IL2RB-1257M
• Product Overview: Recombinant Mouse IL2RB Protein (27-240aa) was expressed in Yeast with N-terminal His-tag.

Specification

• Description: The interleukin 2 receptor is composed of alpha and beta subunits. The beta subunit encoded by this gene is very homologous to the human beta subunit and also shows structural similarity to other cytokine receptors.
• Source: Yeast
• Species: Mouse
• Tag: His
• Form: Tris-based buffer, 50% glycerol.
• Molecular Mass: 27.0 kDa
• AA Sequence: AVKNCSHLECFYNSRANVSCMWSHEEALNVTTCHVHAKSNLRHWNKTCELTLVRQASWACNLILGSFPES
  QSLTSVDLLDINVVCWEEKGWRRVKTCDFHPFDNLRLVAPHSLQVLHIDTQRCNISWKVSQVSHYIEPYL
  EFEARRRLLGHSWEDASVLSLKQRQQWLFLEMLIPSTSYEVQVRVKAQRNNTGTWSPWSQPLTFRTRPAD
  PMKE
• Purity: Greater than 90% as determined by SDS-PAGE.
• Storage: The shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
• Protein length: 27-240 a.a.

Gene Information

• Gene Name: Il2rb interleukin 2 receptor, beta chain [ Mus musculus (house mouse) ]
• Official Symbol: IL2RB
• Synonyms: p70; CD122; IL15Rbeta; Il-2Rbeta; IL-15Rbeta; Il-2/15Rbeta
• Gene ID: 16185
• mRNA Refseq: NM_008368.4
• Protein Refseq: NP_032394.1
• UniProt ID: P16297