Recombinant Mouse Il1f9 protein
Cat.No. : | Il1f9-648M |
Product Overview : | Recombinant Mouse Il1f9 protein was expressed in Escherichia coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | E.coli |
Tag : | Non |
Protein Length : | 152 |
Description : | Interleukin-36 (IL-36) is a pro-inflammatory cytokine which plays an important role in the pathophysiology of several diseases. IL-36α, IL-36β, and IL-36γ (formerly IL-1F6, IL-1F8, and IL-1F9) are IL-1 family members that signal through the IL-1 receptor family members IL-1Rrp2 (IL-1RL2) and IL-1RAcP. IL-36γ is secreted when transfected into 293-T cells and it could constitute part of an independent signaling system analogous to interleukin-1 alpha (IL-1A), beta (IL-1B) receptor agonist and interleukin-1 receptor type I (IL-1R1). Furthermore, IL-36γ also can function as an agonist of NF-kappa B activation through the orphan IL-1-receptor-related protein 2. Recombinant murine IL-36γ is synthesized as a 17.3 kDa, 152 amino acid (a.a.) protein that contains no signal sequence, no prosegment and no potential N-linked glycosylation site. Murine to human, IL-36γ shares 53 % a.a. identity. Within the family, IL-36γ shares about 25 % ~ 55 % a.a. sequence identity with IL-1RA, IL-1β, IL-36RA, IL-36α, IL-37, IL-36β and IL-1F10. |
Form : | Lyophilized from a 0.2μm filtered solution in 1 M MOPS, 10 mM NaAC, pH7.6, with 2 mM EDTA, 5 % Trehalose, 0.02 % Tween-20. |
Bio-activity : | Fully biologically active when compared to standard. The ED50 as determined by inducing IL-6 secretion in murine NIH/3T3 cells is less than 10 ng/ml, corresponding to a specific activity of > 1.0 × 10⁵ IU/mg. |
Molecular Mass : | Approximately 17.3 kDa, a single non-glycosylated polypeptide chain containing 152 amino acids. |
AA Sequence : | GRETPDFGEVFDLDQQVWIFRNQALVTVPRSHRVTPVSVTILPCKYPESLEQDKGIAIYLGIQNPDKCLFCKEVNGHPTLLLKEEKILDLYHHPEPMKPFLFYHTRTGGTSTFESVAFPGHYIASSKTGNPIFLTSKKGEYYNINFNLDIKS |
Endotoxin : | Less than 0.1 EU/μg of rMuIL-36γ, 152a.a. as determined by LAL method. |
Purity : | >97% by SDS-PAGE and HPLC analysis. |
Storage : | Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 centigrade as supplied. 1 month, 2 to 8 centigrade under sterile conditions after reconstitution. 3 months, -20 to -70 centigrade under sterile conditions after reconstitution. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at ≤-20 centigrade. Further dilutions should be made in appropriate buffered solutions. |
Gene Name | Il1f9 |
Official Symbol | Il1f9 |
Synonyms | IL1F9; interleukin 1 family, member 9; interleukin-36 gamma; IL-1F9; interleukin-1 family member 9; Il36g; |
Gene ID | 215257 |
mRNA Refseq | NM_153511 |
Protein Refseq | NP_705731 |
UniProt ID | Q8R460 |
◆ Recombinant Proteins | ||
IL1F9-14173H | Recombinant Human IL1F9, GST-tagged | +Inquiry |
IL36G-13H | Recombinant Human IL36G Protein, His-tagged | +Inquiry |
IL36G-7270H | Recombinant Human IL36G, None tagged | +Inquiry |
IL36G-511H | Recombinant Human IL36G protein | +Inquiry |
Il36g-01M | Active Recombinant Mouse Il36g Protein, His-Tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
IL36G-5235HCL | Recombinant Human IL1F9 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All IL36G Products
Required fields are marked with *
My Review for All IL36G Products
Required fields are marked with *
0
Inquiry Basket