Recombinant Mouse Il1f6 protein

Cat.No. : Il1f6-551M
Product Overview : Recombinant Mouse Il1f6 protein (153 a.a.) was expressed in Escherichia coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Description : Interleukin-36 (IL-36) is a pro-inflammatory cytokine which plays an important role in the pathophysiology of several diseases. IL-36α, IL-36β, and IL-36γ (formerly IL-1F6, IL-1F8, and IL-1F9) are IL-1 family members that signal through the IL-1 receptor family members IL-1Rrp2 (IL-1RL2) and IL-1RAcP. IL-36α is mainly found in skin and lymphoid tissues, but also in fetal brain, trachea, stomach and intestine. It is expressed by monocytes, B and T cells. Notably, IL-36 alpha is the only novel IL-1 family member expressed on T-cells. Recombinant murine interleukin-36 alpha contains 153 amino acids residues which is a single non-glycosylated polypeptide. Specifically, mouse IL-36α shares 83 % a.a. sequence identity with rat IL-36α, 54 – 60 % with human, rabbit, equine and bovine IL-36α.
Source : E.coli
Species : Mouse
Form : Lyophilized from a 0.2μm filtered concentrated solution in PBS, 1 mM DTT, 3 % trehalose.
Bio-activity : Fully biologically active when compared to standard. The ED50 as determined by inducing IL-6 secretion in murine NIH/3T3 cells is less than 25 ng/ml, corresponding to a specific activity of > 4.0 × 10⁴ IU/mg.
Molecular Mass : Approximately 17.1kDa, a single non-glycosylated polypeptide chain containing 153 amino acids.
Protein length : 153
AA Sequence : RAASPSLRHVQDLSSRVWILQNNILTAVPRKEQTVPVTITLLPCQYLDTLETNRGDPTYMGVQRPMSCLFCTKDGEQPVLQLGEGNIMEMYNKKEPVKASLFYHKKSGTTSTFESAAFPGWFIAVCSKGSCPLILTQELGEIFITDFEMIVVH
Endotoxin : Less than 1 EU/μg of rMuIL-36α, 153a.a. as determined by LAL method.
Purity : >95% by SDS-PAGE and HPLC analysis.
Storage : Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 centigrade as supplied. 1 month, 2 to 8 centigrade under sterile conditions after reconstitution. 3 months, -20 to -70 centigrade under sterile conditions after reconstitution.
Reconstitution : We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at ≤-20 centigrade. Further dilutions should be made in appropriate buffered solutions.
Tag : Non
Gene Name Il1f6
Official Symbol Il1f6
Synonyms IL1F6; interleukin 1 family, member 6; interleukin-36 alpha; IL-1F6; Fil1epsilon; FIL1 epsilon; IL-1 epsilon; interleukin-1 epsilon; interleukin-1 homolog 1; interleukin-1 family member 6; interleukin 1 family, member 9; interleukin 1 family, member 6 (epsilon); Fil1; Il1f9; Il36a; IL-1H1; IL1RP2; MGC151479; MGC151481;
Gene ID 54448
mRNA Refseq NM_019450
Protein Refseq NP_062323
UniProt ID Q9JLA2

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All IL36A Products

Required fields are marked with *

My Review for All IL36A Products

Required fields are marked with *

0

Inquiry Basket

cartIcon