Recombinant Mouse Il1b Protein, His-tagged

• Cat.No.: Il1b-7238M
• Product Overview: Recombinant mouse IL-1beta, fused to His tag, was expressed in E. coli and purified by using conventional chromatography techniques.

Specification

• Species: Mouse
• Source: E.coli
• Tag: His
• Protein Length: 118-269
• Description: The protein encoded by this gene is a member of the interleukin 1 cytokine family. This cytokine is produced by activated macrophages as a proprotein, which is proteolytically processed to its active form by caspase 1. The encoded protein plays a role in thymocyte proliferation and is involved in the inflammatory response.
• Form: Liquid
• Molecular Mass: 21 kDa
• AA Sequence: MRGSHHHHHHGMASMTGGQQMGRDLYDDDDKDRWGSMVPIRQLHYRLRDEQQKSLVLSDPYELKALHLNGQNINQQVIFSMSFVQGEPSNDKIPVALGLKGKNLYLSCVMKDGTPTLQLESVDPKQYPKKKMEKRFVFNKIEVKSKVEFESAEFPNWYISTSQAEHKPVFLGNNSGQDIIDFTMESVSS
• Purity: > 90 % by SDS-PAGE
• Stability: Shelf life: one year from despatch.
• Storage: Store undiluted at 2-8 centigrade for one week or (in aliquots) at -20 to -80 centigrade for longer. Avoid repeated freezing and thawing.
• Concentration: 1.0 mg/mL (determined by Bradford assay)
• Storage Buffer: 20 mM Tris pH 8.0, 10 % glycerol

Gene Information

• Gene Name: Il1b interleukin 1 beta [ Mus musculus (house mouse) ]
• Official Symbol: Il1b
• Synonyms: Il1b; interleukin 1 beta; IL-; Il-1b; IL-1beta; interleukin-1 beta; IL-1 beta
• Gene ID: 16176
• mRNA Refseq: NM_008361
• Protein Refseq: NP_032387
• UniProt ID: P10749