Recombinant il1b Proteins
- Product List
- Specification
- Gene Information
- Cat. #
- Tag
- Source (Host)
- Species
- Protein Length
- Price
- Datasheet
- IL1B-132H
- Non
- E.coli
- Human
- 117-269 a.a.
-
- Il1b-383M
- Non
- E.coli
- Mouse
- Val118-Ser269
-
- Il1b-384R
- His
- E.coli
- Rat
- Met1-Ser268
-
- IL1B-577R
- His
- E.coli
- Rat
- 117-268 a.a.
-
- IL1B-744H
- His
- E.coli
- Human
- Met1-Ser269
-
.jpg)
.jpg)
.jpg)
.jpg)
.jpg)
| Description : | Interleukin-1 (IL-1) has been considered a potentially important inflammatory mediator. It is composed of two distinct proteins, called as IL-1alpha and IL-1beta. IL-1beta is a proinflammatory cytokine produced in a variety of cells including monocytes, tissue macrophages, keratinocytes and other epithelial cells. Both IL-1alpha and IL-1beta bind to the same receptor and they are structurally related polypeptides that share approximately 20% amino acid. |
| Source : | E. coli |
| Species : | Human |
| Form : | Liquid |
| Bio-activity : | Measured in a cell proliferation assay using D10.G4.1 mouse helper T cells. The ED50 for this effect is less or euqal to 0.005 ng/ml. |
| Molecular Mass : | 17 kDa |
| AA Sequence : | MAPVRSLNCTLRDSQQKSLVMSGPYELKALHLQGQDMEQQVVFSMSFVQGEESNDKIPVALGLKEKNLYLSCVLKDDKPTLQLESVDPKNYPKKKMEKRFVFNKIEINNKLEFESAQFPNWYISTSQAENMPVFLGGTKGGQDITDFTMQFVSS |
| Endotoxin : | < 1.0 EU per 1 microgram of protein (determined by LAL method) |
| Purity : | > 95% by SDS-PAGE |
| Storage : | Can be stored at 4 centigrade short term (1-2 weeks). For long term storage, aliquot and store at -20 centigrade or -70 centigrade. Avoid repeated freezing and thawing cycles. |
| Concentration : | 1 mg/mL (determined by BCA assay) |
| Storage Buffer : | PBS pH7.4 |
| Tag : | Non |
| Protein length : | 117-269 a.a. |
| Gene Name | IL1B |
| Official Symbol | IL1B interleukin 1 beta [ Homo sapiens (human) ] |
| Synonyms | IL1B; interleukin 1 beta; IL-1; IL1F2; IL1-BETA; interleukin-1 beta; IL-1 beta; catabolin; preinterleukin 1 beta; pro-interleukin-1-beta |
| Gene ID | 3553 |
| mRNA Refseq | NM_000576 |
| Protein Refseq | NP_000567 |
| MIM | 147720 |
| UniProt ID | P01584 |
