Recombinant Mouse Il1a Protein, His-tagged

• Cat.No.: Il1a-7236M
• Product Overview: Recombinant mouse IL1a protein, fused to His-tag at N-terminus, was expressed in E. coli.

Specification

• Species: Mouse
• Source: E.coli
• Tag: His
• Protein Length: 115-270
• Description: Produced by activated macrophages, IL-1 stimulates thymocyte proliferation by inducing IL-2 release, B-cell maturation and proliferation, and fibroblast growth factor activity. IL-1 proteins are involved in the inflammatory response, being identified as endogenous pyrogens, and are reported to stimulate the release of prostaglandin and collagenase from synovial cells.
• Form: Liquid
• Molecular Mass: 20.4 kDa
• AA Sequence: MGSSHHHHHHSSGLVPRGSHMGSSAPYTYQSDLRYKLMKLVRQKFVMNDSLNQTIYQDVDKHYLSTTWLNDLQQEVKFDMYAYSSGGDDSKYPVTLKISDSQLFVSAQGEDQPVLLKELPETPKLITGSETDLIFFWKSINSKNYFTSAAYPELFIATKEQSRVHLARGLPSMTDFQIS
• Purity: > 85 % by SDS-PAGE
• Stability: Shelf life: one year from despatch.
• Storage: Store undiluted at 2-8 centigrade for one week or (in aliquots) at -20 to -80 centigrade for longer. Avoid repeated freezing and thawing.
• Concentration: 1.0 mg/mL (determined by Bradford assay)
• Storage Buffer: Phosphate buffer saline (pH 7.4) containing 10 % glycerol.

Gene Information

• Gene Name: Il1a interleukin 1 alpha [ Mus musculus (house mouse) ]
• Official Symbol: Il1a
• Synonyms: Il1a; interleukin 1 alpha; Il; Il-1a; interleukin-1 alpha; IL-1 alpha
• Gene ID: 16175
• mRNA Refseq: NM_010554
• Protein Refseq: NP_034684
• UniProt ID: P01582