Recombinant Mouse Il19 protein

• Cat.No.: Il19-72M
• Product Overview: Recombinant Mouse Il19 protein was expressed in Escherichia coli.

Specification

• Species: Mouse
• Source: E.coli
• Tag: Non
• Protein Length: 152
• Description: Interleukin-19 (IL-19) belongs to the IL-10 family that includes IL-10, IL-20, IL-22, IL-24, and IL-26. As a monomer made of seven amphipathic helices, IL-19 has a helical bundle and shares the same cell surface receptor (IL-20R) with IL-20 and IL-24. It may play some important roles in inflammatory responses because it up-regulates IL-6 and TNF-alpha and induces apoptosis.
• Form: Lyophilized from a 0.2μm filtered concentrated solution in PBS, pH 7.4, with 3 % Trehalose.
• Bio-activity: Fully biologically active when compared to standard. The ED50 as determined by a cell proliferation assay using human IL-20Rα and human IL-20Rβ co-transfected murine BaF3 pro-B cells is less than 0.8 ng/ml, corresponding to a specific activity of > 1.25 × 10⁶ IU/mg.
• Molecular Mass: Approximately 17.6 kDa, a single non-glycosylated polypeptide chain containing 152 amino acids.
• AA Sequence: LRRCLISVDMRLIEKSFHEIKRAMQTKDTFKNVTILSLENLRSIKPGDVCCMTNNLLTFYRDRVFQDHQERSLEVLRRISSIANSFLCVQKSLERCQVHRQCNCSQEATNATRIIHDNYNQLEVSSAALKSLGELNILLAWIDRNHLETPAA
• Endotoxin: Less than 0.1 EU/µg of rMuIL-19 as determined by LAL method.
• Purity: >97% by SDS-PAGE and HPLC analysis.
• Storage: Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 centigrade as supplied. 1 month, 2 to 8 centigrade under sterile conditions after reconstitution. 3 months, -20 to -70 centigrade under sterile conditions after reconstitution.
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at ≤-20 centigrade. Further dilutions should be made in appropriate buffered solutions.

Gene Information

• Gene Name: Il19
• Official Symbol: Il19
• Synonyms: IL19; interleukin 19; interleukin-19; IL-19
• Gene ID: 329244
• mRNA Refseq: NM_001009940
• Protein Refseq: NP_001009940
• UniProt ID: Q8CJ70