Recombinant Active Human IL19 Protein, His-tagged(C-ter)

• Cat.No.: IL19-156H
• Product Overview: Recombinant Active Human IL19 Protein with His tag (C-ter) was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Description: The protein encoded by this gene is a cytokine that belongs to the IL10 cytokine subfamily. This cytokine is found to be preferentially expressed in monocytes. It can bind the IL20 receptor complex and lead to the activation of the signal transducer and activator of transcription 3 (STAT3). A similar cytokine in mouse is reported to up-regulate the expression of IL6 and TNF-alpha and induce apoptosis, which suggests a role of this cytokine in inflammatory responses. Alternatively spliced transcript variants encoding the distinct isoforms have been described. [provided by RefSeq, Jul 2008]
• Form: Powder
• Bio-activity: Determined by its ability to induce proliferation in BaF3 mouse pro-B cells transfected with human IL-20 R alpha and human IL-20 R beta. The ED50 for this effect is < 1.2 ng/mL.
• AA Sequence: MLRRCLISTDMHHIEESFQEIKRAIQAKDTFPNVTILSTLETLQIIKPLDVCCVTKNLLAFYVDRVFKDHQEPNPKILRKISSIANSFLYMQKTLRQCQEQRQCHCRQEATNATRVIHDNYDQLEVHAAAIKSLGELDVFLAWINKNHEVMSSA
• Endotoxin: Endotoxin level is less than 0.1 EU/μg of the protein, as determined by the LAL test.
• Purity: > 98% (by SDS-PAGE)
• Applications: SDS-PAGE
• Notes: For laboratory research only, not for drug, diagnostic or other use.
• Storage: Lyophilized protein should be stored at -20°C. After reconstitution, aliquot and store at -20°C or -80°C for up to one month. Storage in frost free freezers is not recommended. Avoid repeated freeze/thaw cycles. Suggest spin the vial prior to opening.
• Storage Buffer: PBS (pH 8.0)
• Reconstitution: It is recommended to reconstitute the lyophilized protein in sterile water to a concentration not less than 100 μg/mL and incubate the stock solution for at least 20 min at room temperature to make sure the protein is dissolved completely.

Gene Information

• Gene Name: IL19 interleukin 19 [ Homo sapiens ]
• Official Symbol: IL19
• Synonyms: IL19; interleukin 19; interleukin-19; IL 10C; IL 19; MDA1; melanoma differentiation associated protein like protein; NG.1; ZMDA1; melanoma differentiation associated protein-like protein; melanoma differentiation-associated protein-like protein; IL-10C
• Gene ID: 29949
• mRNA Refseq: NM_013371
• Protein Refseq: NP_037503
• MIM: 605687
• UniProt ID: Q9UHD0