Recombinant Mouse Il13 Protein

• Cat.No.: Il13-088M
• Product Overview: Purified recombinant protein of Mouse interleukin 13 (Il13) without tag was expressed in E.coli.

Specification

• Species: Mouse
• Source: E.coli
• Description: Cytokine. Inhibits inflammatory cytokine production. Synergizes with IL2 in regulating interferon-gamma synthesis. May be critical in regulating inflammatory and immune responses. Positively regulates IL31RA expression in macrophages.
• Molecular Mass: 12.2 kDa
• AA Sequence: MPVPRSVSLPLTLKELIEELSNITQDQTPLCNGSMVWSVDLAAGGFCVALDSLTNISNCNAIYRTQRILHGLCNRKAPTTVSSLPDTKIEVAHFITKLLSYTKQLFRHGPF
• Endotoxin: Endotoxin level is < 0.1 ng/µg of protein (< 1 EU/µg)
• Purity: >95%, as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for at least 6 months from date of receipt under proper storage and handling conditions.
• Storage: Store at -80 centigrade.
• Storage Buffer: Lyophilized from a 0.2 µM filtered solution of 20mM PB, 150mM NaCl, pH 7.2
• Reconstitution: Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 µg/ml. Dissolve the lyophilized protein in 1X PBS. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.

Gene Information

• Gene Name: Il13 interleukin 13 [ Mus musculus (house mouse) ]
• Official Symbol: Il13
• Synonyms: Il13; interleukin 13; Il-13; interleukin-13; T-cell activation protein P600
• Gene ID: 16163
• mRNA Refseq: NM_008355
• Protein Refseq: NP_032381
• UniProt ID: P20109