Recombinant Mouse Il11 protein

• Cat.No.: Il11-161M
• Product Overview: Recombinant Mouse Il11 protein was expressed in Escherichia coli.

Specification

• Species: Mouse
• Source: E.coli
• Tag: Non
• Protein Length: 179
• Description: Interleukin-11 (IL-11) is encoded by the II11 gene. IL-11 is a multifunctional cytokine first isolated from bone marrow-derived stromal cells. IL-11 receptor activation requires formation of a complex of two IL-11 molecules with two molecules of the ligand-binding IL-11 Rα subunit and two molecules of the expressed cell signaling β subunit, gp130. IL-11 is a member of the IL-6 superfamily, distinguished based on their use of the common co-receptor gp130. IL-11 can directly stimulate the proliferation of hematopoietic stem cells and megakaryocyte progenitor cells, and induce megakaryocyte maturation resulting in increased platelet production. Mature murine IL-11 shares 88 % amino acid sequence identity with human IL-11.
• Form: Lyophilized from a 0.2μm filtered solution in PBS, pH 7.4.
• Bio-activity: Fully biologically active when compared to standard. The ED50 as determined by a cell proliferation assay using murine T11 cells is less than 2 ng/ml, corresponding to a specific activity of > 5.0 × 10⁵ IU/mg.
• Molecular Mass: Approximately 19.1 kDa, a single non-glycosylated polypeptide chain containing 179 amino acids.
• AA Sequence: MPGPPAGSPRVSSDPRADLDSAVLLTRSLLADTRQLAAQMRDKFPADGDHSLDSLPTLAMSAGTLGSLQLPGVLTRLRVDLMSYLRHVQWLRRAGGPSLKTLEPELGALQARLERLLRRLQLLMSRLALPQAAPDQPVIPLGPPASAWGSIRAAHAILGGLHLTLDWAVRGLLLLKTRL
• Endotoxin: Less than 1 EU/µg of rMuIL-11 as determined by LAL method.
• Purity: >97% by SDS-PAGE and HPLC analysis.
• Storage: Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 centigrade as supplied. 1 month, 2 to 8 centigrade under sterile conditions after reconstitution. 3 months, -20 to -70 centigrade under sterile conditions after reconstitution.
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at ≤-20 centigrade. Further dilutions should be made in appropriate buffered solutions.

Gene Information

• Gene Name: Il11
• Official Symbol: Il11
• Synonyms: IL11; interleukin 11; interleukin-11; IL-11
• Gene ID: 16156
• mRNA Refseq: NM_008350
• Protein Refseq: NP_032376
• UniProt ID: P47873