Recombinant Mouse Il11 protein
Cat.No. : | Il11-161M |
Product Overview : | Recombinant Mouse Il11 protein was expressed in Escherichia coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | E.coli |
Tag : | Non |
Protein Length : | 179 |
Description : | Interleukin-11 (IL-11) is encoded by the II11 gene. IL-11 is a multifunctional cytokine first isolated from bone marrow-derived stromal cells. IL-11 receptor activation requires formation of a complex of two IL-11 molecules with two molecules of the ligand-binding IL-11 Rα subunit and two molecules of the expressed cell signaling β subunit, gp130. IL-11 is a member of the IL-6 superfamily, distinguished based on their use of the common co-receptor gp130. IL-11 can directly stimulate the proliferation of hematopoietic stem cells and megakaryocyte progenitor cells, and induce megakaryocyte maturation resulting in increased platelet production. Mature murine IL-11 shares 88 % amino acid sequence identity with human IL-11. |
Form : | Lyophilized from a 0.2μm filtered solution in PBS, pH 7.4. |
Bio-activity : | Fully biologically active when compared to standard. The ED50 as determined by a cell proliferation assay using murine T11 cells is less than 2 ng/ml, corresponding to a specific activity of > 5.0 × 10⁵ IU/mg. |
Molecular Mass : | Approximately 19.1 kDa, a single non-glycosylated polypeptide chain containing 179 amino acids. |
AA Sequence : | MPGPPAGSPRVSSDPRADLDSAVLLTRSLLADTRQLAAQMRDKFPADGDHSLDSLPTLAMSAGTLGSLQLPGVLTRLRVDLMSYLRHVQWLRRAGGPSLKTLEPELGALQARLERLLRRLQLLMSRLALPQAAPDQPVIPLGPPASAWGSIRAAHAILGGLHLTLDWAVRGLLLLKTRL |
Endotoxin : | Less than 1 EU/µg of rMuIL-11 as determined by LAL method. |
Purity : | >97% by SDS-PAGE and HPLC analysis. |
Storage : | Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 centigrade as supplied. 1 month, 2 to 8 centigrade under sterile conditions after reconstitution. 3 months, -20 to -70 centigrade under sterile conditions after reconstitution. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at ≤-20 centigrade. Further dilutions should be made in appropriate buffered solutions. |
Gene Name | Il11 |
Official Symbol | Il11 |
Synonyms | IL11; interleukin 11; interleukin-11; IL-11; |
Gene ID | 16156 |
mRNA Refseq | NM_008350 |
Protein Refseq | NP_032376 |
UniProt ID | P47873 |
◆ Recombinant Proteins | ||
IL11-131M | Active Recombinant Mouse IL11 Protein | +Inquiry |
IL11-2597H | Active Recombinant Human IL11 protein | +Inquiry |
IL11-061H | Active Recombinant Human IL11 Protein | +Inquiry |
IL11-503H | Recombinant Human IL11 protein, His-tagged | +Inquiry |
IL11-137H | Recombinant Active Human IL11 Protein, His-tagged(N-ter) | +Inquiry |
◆ Cell & Tissue Lysates | ||
IL11-5249HCL | Recombinant Human IL11 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Il11 Products
Required fields are marked with *
My Review for All Il11 Products
Required fields are marked with *
0
Inquiry Basket