Recombinant Mouse IgG Protein
Cat.No. : | IgG-746M |
Product Overview : | Recombinant Mouse IgG protein without tag was expressed in HEK293. |
- Specification
- Gene Information
- Related Products
- Download
Description : | Immunoglobulin G (IgG) is the major class of immunoglobulins. About three-quarters of all serum immunoglobulins belong to this class. IgG molecules consist of two heavy γ and two light chains (2γ + 2L). |
Source : | HEK293 |
Species : | Mouse |
Form : | Lyophilized |
Molecular Mass : | 26.4 kDa |
Protein length : | 330 |
AA Sequence : | AKTTAPSVYPLAPVCGDTTGSSVTLGCLVKGYFPEPVTLTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVTSSTWPSQSITCNVAHPASSTKVDKKIEPRGPTIKPCPPCKCPAPNLLGGPSVFIFPPKIKDVLMISLSPIVTCVVVDVSEDDPDVQISWFVNNVEVHTAQTQTHREDYNSTLRVVSALPIQHQDWMSGKEFKCKVNNKDLPAPIERTISKPKGSVRAPQVYVLPPPEEEMTKKQVTLTCMVTDFMPEDIYVEWTNNGKTELNYKNTEPVLDSDGSYFMYSKLRVEKKNWVERNSYSCSVVHEGLHNHHTTKSFSRTPGK |
Purity : | > 98% |
Applications : | WB; ELISA; FACS; FC |
Stability : | This bioreagent is stable at 4 centigrade (short-term) and -70 centigrade(long-term). After reconstitution, sample may be stored at 4 centigrade for 2-7 days and below -18 centigrade for future use. |
Storage : | At -20 centigrade. |
Concentration : | 1 mg/mL |
Storage Buffer : | PBS (pH 7.4-7.5). Sterile-filtered colorless solution. |
Reconstitution : | Reconstitute in sterile distilled H2O to no less than 100 μg/mL; dilute reconstituted stock further in other aqueous solutions if needed. Please review COA for lot-specific instructions. Final measurements should be determined by the end-user for optimal performance. |
Official Symbol | IgG |
Synonyms | IGHG2a; IgG; IgG2a |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All IgG Products
Required fields are marked with *
My Review for All IgG Products
Required fields are marked with *
0
Inquiry Basket